BLASTX nr result
ID: Lithospermum23_contig00028199
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00028199 (589 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP19525.1 unnamed protein product [Coffea canephora] 57 2e-06 >CDP19525.1 unnamed protein product [Coffea canephora] Length = 305 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/67 (37%), Positives = 33/67 (49%) Frame = -1 Query: 202 EKKRVVDNGPWCFDS*LLVMKDWIRGANPLGFRFDECTFWIHVRGLNAKFFTWDVASKLA 23 +KK+V GPWCFD LLV+ D+I P + D C+FW+ V L + A L Sbjct: 3 DKKKVFSGGPWCFDDNLLVISDYIGNVQPTNIKLDTCSFWVRVYNLPLSWMNVKTAEYLG 62 Query: 22 NSFPACE 2 N E Sbjct: 63 NKLGVYE 69