BLASTX nr result
ID: Lithospermum23_contig00028167
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00028167 (570 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV37447.1 hypothetical protein F511_24854 [Dorcoceras hygrometr... 64 1e-08 XP_011088278.1 PREDICTED: B3 domain-containing protein At5g42700... 62 3e-08 XP_011088276.1 PREDICTED: B3 domain-containing protein At3g19184... 62 3e-08 KZV17764.1 hypothetical protein F511_01573 [Dorcoceras hygrometr... 61 6e-08 EPS67918.1 hypothetical protein M569_06855, partial [Genlisea au... 54 4e-07 CDO97164.1 unnamed protein product [Coffea canephora] 58 9e-07 >KZV37447.1 hypothetical protein F511_24854 [Dorcoceras hygrometricum] Length = 286 Score = 63.5 bits (153), Expect = 1e-08 Identities = 46/106 (43%), Positives = 60/106 (56%), Gaps = 14/106 (13%) Frame = +3 Query: 138 NSHFYEANVFVKCLL*ILDDTPKGL---VRTRYCKLYLPNCDSSI----ERGCEFRTTYL 296 N H Y F+KC+L + G + ++C L+LPN DSSI E G E+RT+YL Sbjct: 73 NEHPY----FLKCML--PSNVSHGFWLHLPKKFCSLHLPNHDSSIVLVDEWGNEYRTSYL 126 Query: 297 VERRGLA---RGDSNSHGLLKGEILSFSVD*GCKFKVH----HGRD 413 + R GL+ RG S SH LLKG++L F + CK KVH HG D Sbjct: 127 LWRHGLSAGWRGFSKSHRLLKGDVLIFHLIEPCKLKVHIVRVHGPD 172 >XP_011088278.1 PREDICTED: B3 domain-containing protein At5g42700-like isoform X2 [Sesamum indicum] Length = 301 Score = 62.4 bits (150), Expect = 3e-08 Identities = 40/89 (44%), Positives = 55/89 (61%), Gaps = 10/89 (11%) Frame = +3 Query: 165 FVKCLL*ILDDTPKGL---VRTRYCKLYLPNCDSSI----ERGCEFRTTYLVERRGLA-- 317 FVKC+L + G + ++C ++LPN D+SI E G E++T+YL+ER GL+ Sbjct: 108 FVKCML--PSNVAHGFWLHLPKKFCSVHLPNHDTSIVLVDEWGNEYKTSYLLERHGLSAG 165 Query: 318 -RGDSNSHGLLKGEILSFSVD*GCKFKVH 401 RG S SH LLKG+IL F + CK KVH Sbjct: 166 WRGFSISHRLLKGDILIFHLTGPCKLKVH 194 >XP_011088276.1 PREDICTED: B3 domain-containing protein At3g19184-like isoform X1 [Sesamum indicum] Length = 313 Score = 62.4 bits (150), Expect = 3e-08 Identities = 40/89 (44%), Positives = 55/89 (61%), Gaps = 10/89 (11%) Frame = +3 Query: 165 FVKCLL*ILDDTPKGL---VRTRYCKLYLPNCDSSI----ERGCEFRTTYLVERRGLA-- 317 FVKC+L + G + ++C ++LPN D+SI E G E++T+YL+ER GL+ Sbjct: 108 FVKCML--PSNVAHGFWLHLPKKFCSVHLPNHDTSIVLVDEWGNEYKTSYLLERHGLSAG 165 Query: 318 -RGDSNSHGLLKGEILSFSVD*GCKFKVH 401 RG S SH LLKG+IL F + CK KVH Sbjct: 166 WRGFSISHRLLKGDILIFHLTGPCKLKVH 194 >KZV17764.1 hypothetical protein F511_01573 [Dorcoceras hygrometricum] Length = 241 Score = 60.8 bits (146), Expect = 6e-08 Identities = 40/89 (44%), Positives = 53/89 (59%), Gaps = 10/89 (11%) Frame = +3 Query: 165 FVKCLL*ILDDTPKGL---VRTRYCKLYLPNCDSSI----ERGCEFRTTYLVERRGLA-- 317 FVKC+L + G + ++C LY PN DS+I E G E++T+YL+ER GL+ Sbjct: 43 FVKCML--PSNVAHGFWLHLPKKFCTLYFPNRDSTICLVDEWGNEYKTSYLLERHGLSAG 100 Query: 318 -RGDSNSHGLLKGEILSFSVD*GCKFKVH 401 RG S SH LL G+IL F + CK KVH Sbjct: 101 WRGFSISHRLLNGDILIFHLIEPCKLKVH 129 >EPS67918.1 hypothetical protein M569_06855, partial [Genlisea aurea] Length = 139 Score = 53.9 bits (128), Expect(2) = 4e-07 Identities = 30/67 (44%), Positives = 45/67 (67%), Gaps = 7/67 (10%) Frame = +3 Query: 222 RYCKLYLPNCDSSI----ERGCEFRTTYLVERRGLA---RGDSNSHGLLKGEILSFSVD* 380 ++C+ ++P+ D+++ E G E+R T+L+ R GL+ RG S SH LLKG+IL F + Sbjct: 56 KFCEAHMPDHDTNVSLVNEWGKEYRATFLLGRYGLSAGWRGFSISHRLLKGDILIFHLIQ 115 Query: 381 GCKFKVH 401 CKFKVH Sbjct: 116 PCKFKVH 122 Score = 27.7 bits (60), Expect(2) = 4e-07 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 133 DEIPTFTKRMFSSNVCYRFWMTLPR 207 +++P F K M SNV FW+ LP+ Sbjct: 31 NDLPHFVKFMLHSNVGQGFWLHLPK 55 >CDO97164.1 unnamed protein product [Coffea canephora] Length = 320 Score = 58.2 bits (139), Expect = 9e-07 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 11/79 (13%) Frame = +3 Query: 210 LVRTRYCKLYLPNCDSSI----ERGCEFRTTYLVERRGLA---RGDSNSHGLLKGEILSF 368 ++ ++ L+LP+ DS++ E G E++TTYL++R GL+ RG S SH LLKG+IL F Sbjct: 128 IIPRKFGSLHLPSRDSTVILVDEWGKEYKTTYLIDRNGLSAGWRGFSMSHRLLKGDILIF 187 Query: 369 SVD*GCKFKVH----HGRD 413 + CK KVH HG D Sbjct: 188 RLIGHCKLKVHIVRVHGLD 206