BLASTX nr result
ID: Lithospermum23_contig00027498
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00027498 (255 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV80864.1 hypothetical protein CFOL_v3_24324 [Cephalotus follic... 64 3e-11 GAV59964.1 zf-RVT domain-containing protein [Cephalotus follicul... 64 8e-11 GAV62613.1 zf-RVT domain-containing protein, partial [Cephalotus... 62 8e-10 GAV66493.1 zf-RVT domain-containing protein [Cephalotus follicul... 63 9e-10 GAV67657.1 zf-RVT domain-containing protein [Cephalotus follicul... 60 2e-09 GAV93084.1 zf-RVT domain-containing protein, partial [Cephalotus... 62 2e-09 GAV82119.1 hypothetical protein CFOL_v3_25572, partial [Cephalot... 59 3e-09 GAV77512.1 zf-RVT domain-containing protein [Cephalotus follicul... 62 3e-09 GAV74389.1 zf-RVT domain-containing protein [Cephalotus follicul... 61 6e-09 GAV61177.1 zf-RVT domain-containing protein [Cephalotus follicul... 59 6e-09 GAV65878.1 zf-RVT domain-containing protein [Cephalotus follicul... 60 7e-09 GAV67837.1 zf-RVT domain-containing protein, partial [Cephalotus... 60 8e-09 GAV58865.1 zf-RVT domain-containing protein [Cephalotus follicul... 58 9e-09 GAV92516.1 hypothetical protein CFOL_v3_35895 [Cephalotus follic... 57 1e-08 GAV85209.1 zf-RVT domain-containing protein [Cephalotus follicul... 60 1e-08 GAV58142.1 zf-RVT domain-containing protein [Cephalotus follicul... 60 1e-08 GAV76619.1 zf-RVT domain-containing protein [Cephalotus follicul... 58 1e-08 GAV66547.1 hypothetical protein CFOL_v3_10057 [Cephalotus follic... 56 3e-08 XP_019261681.1 PREDICTED: uncharacterized protein LOC109239557 [... 59 3e-08 GAV73542.1 zf-RVT domain-containing protein [Cephalotus follicul... 57 3e-08 >GAV80864.1 hypothetical protein CFOL_v3_24324 [Cephalotus follicularis] Length = 134 Score = 64.3 bits (155), Expect = 3e-11 Identities = 32/81 (39%), Positives = 49/81 (60%), Gaps = 1/81 (1%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W +E++W+V+ GK + RLR + AIYHIWL RNRK F + I+ K DV Sbjct: 46 WLEEIQWMVEHSKGKQLQHRLRKVAFGAAIYHIWLERNRKCFRNSYIPPQEIIRKIQGDV 105 Query: 71 RACVGSW-RHVTRNKQNWSIC 12 RA + S+ + R++Q++S+C Sbjct: 106 RAKLVSFAKRRNRSEQDYSLC 126 >GAV59964.1 zf-RVT domain-containing protein [Cephalotus follicularis] Length = 149 Score = 63.5 bits (153), Expect = 8e-11 Identities = 29/80 (36%), Positives = 47/80 (58%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W DEV+W++ G+ F S +R L ++YHIWL RNR+ F++E +N I++K DV Sbjct: 62 WSDEVQWMLDHAKGQKFPSLVRKLAFAASVYHIWLERNRRCFKNEFMPANEIINKIKHDV 121 Query: 71 RACVGSWRHVTRNKQNWSIC 12 + R R +++ S+C Sbjct: 122 SLKLWLGRKSQRCERHHSLC 141 >GAV62613.1 zf-RVT domain-containing protein, partial [Cephalotus follicularis] Length = 182 Score = 61.6 bits (148), Expect = 8e-10 Identities = 27/80 (33%), Positives = 47/80 (58%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W DEV+W++ G+ F S +R L + ++YHIWL RNR+ F++E + I+++ DV Sbjct: 95 WSDEVQWMLDHARGQKFPSLVRKLAFVASVYHIWLERNRRCFKNEFMPAKEIINRVKHDV 154 Query: 71 RACVGSWRHVTRNKQNWSIC 12 + R + R + + S+C Sbjct: 155 ALKLWLGRKLQRCEWHHSLC 174 >GAV66493.1 zf-RVT domain-containing protein [Cephalotus follicularis] Length = 493 Score = 63.2 bits (152), Expect = 9e-10 Identities = 29/80 (36%), Positives = 46/80 (57%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W DEV+W++ G+ F S +R L ++YHIWL RNR+ F++E +N I+ K DV Sbjct: 406 WSDEVQWMLDHAKGQKFPSLVRKLAFAASVYHIWLERNRRCFKNEFMPANEIIDKIKHDV 465 Query: 71 RACVGSWRHVTRNKQNWSIC 12 + R R +++ S+C Sbjct: 466 SLKLWLGRKSQRCERHHSLC 485 >GAV67657.1 zf-RVT domain-containing protein [Cephalotus follicularis] Length = 149 Score = 60.1 bits (144), Expect = 2e-09 Identities = 27/80 (33%), Positives = 46/80 (57%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W DEV+W++ G+ F S +R L ++YHIWL RNR+ F++E + I+++ DV Sbjct: 62 WSDEVQWMLDHARGQKFPSLVRKLAFAASVYHIWLERNRRCFKNEFMPAKEIINRIKHDV 121 Query: 71 RACVGSWRHVTRNKQNWSIC 12 + R + R + + S+C Sbjct: 122 ALKLWLGRKLQRCEWHHSLC 141 >GAV93084.1 zf-RVT domain-containing protein, partial [Cephalotus follicularis] Length = 299 Score = 61.6 bits (148), Expect = 2e-09 Identities = 27/82 (32%), Positives = 42/82 (51%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W++EVRW+ + G SF +R L +YH+WL RNR+ F + IV K +DV Sbjct: 202 WDNEVRWMTEHARGNSFPHMVRKLAFAATVYHVWLERNRRCFSNRFLLPQDIVHKVSMDV 261 Query: 71 RACVGSWRHVTRNKQNWSICTD 6 + + RN + S+C + Sbjct: 262 SGKIAIANNAQRNDHHHSLCVN 283 >GAV82119.1 hypothetical protein CFOL_v3_25572, partial [Cephalotus follicularis] Length = 125 Score = 58.9 bits (141), Expect = 3e-09 Identities = 27/82 (32%), Positives = 44/82 (53%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W DEV+W++ G F + +R L +IYHIWL RNR+ F+++ I+ + DV Sbjct: 43 WMDEVQWMLDHARGHKFPALVRKLAFATSIYHIWLERNRRCFKNQFMPVQEIIDRIKYDV 102 Query: 71 RACVGSWRHVTRNKQNWSICTD 6 +G R R + + S+C + Sbjct: 103 AWKMGLGRKTQRCQWHHSLCVN 124 >GAV77512.1 zf-RVT domain-containing protein [Cephalotus follicularis] Length = 394 Score = 61.6 bits (148), Expect = 3e-09 Identities = 28/80 (35%), Positives = 46/80 (57%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W DEV+W++ GK F S +R L ++YHIWL RNR+ F++E + I+++ DV Sbjct: 307 WSDEVQWMLDHAKGKKFPSLVRKLAFAASVYHIWLERNRRCFKNEFMPAKEIINRIKHDV 366 Query: 71 RACVGSWRHVTRNKQNWSIC 12 + R + R + + S+C Sbjct: 367 SLKLWLGRKLQRCEWHHSLC 386 >GAV74389.1 zf-RVT domain-containing protein [Cephalotus follicularis] Length = 493 Score = 60.8 bits (146), Expect = 6e-09 Identities = 28/80 (35%), Positives = 46/80 (57%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W DEV+W++ G+ F S +R L ++YHIWL RNR+ F++E + I++K DV Sbjct: 406 WSDEVQWMLDHARGQKFPSLVRKLAFAASVYHIWLERNRRCFKNEFTPAKEIINKIKHDV 465 Query: 71 RACVGSWRHVTRNKQNWSIC 12 + R + R + + S+C Sbjct: 466 ALKLWLGRKLQRCEWHHSLC 485 >GAV61177.1 zf-RVT domain-containing protein [Cephalotus follicularis] Length = 162 Score = 58.9 bits (141), Expect = 6e-09 Identities = 26/82 (31%), Positives = 46/82 (56%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W DEV+W+++ G F + +R L + +IYHIWL RNR+ F+++ + I+ + DV Sbjct: 62 WMDEVQWMLEHARGHKFPALVRKLAFVASIYHIWLERNRRCFKNQFMPAQEIIDRIKQDV 121 Query: 71 RACVGSWRHVTRNKQNWSICTD 6 + R R + + S+C + Sbjct: 122 ALKMWLGRKTQRCEWHHSLCVN 143 >GAV65878.1 zf-RVT domain-containing protein [Cephalotus follicularis] Length = 259 Score = 60.1 bits (144), Expect = 7e-09 Identities = 27/80 (33%), Positives = 46/80 (57%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W DEV+W++ G+ F S +R L ++YHIWL RNR+ F++E + I+++ DV Sbjct: 172 WSDEVQWMLDHARGQKFPSLVRKLAFAASVYHIWLERNRRCFKNEFMPAKDIINRIKHDV 231 Query: 71 RACVGSWRHVTRNKQNWSIC 12 + R + R + + S+C Sbjct: 232 SLKLWLGRKLQRCEWHHSLC 251 >GAV67837.1 zf-RVT domain-containing protein, partial [Cephalotus follicularis] Length = 454 Score = 60.5 bits (145), Expect = 8e-09 Identities = 26/80 (32%), Positives = 46/80 (57%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W DEV+W++ G F +R+R L ++YHIWL RNR+ F++E + ++++ DV Sbjct: 366 WSDEVQWMLDHARGHKFPTRVRKLAFAASVYHIWLERNRRCFKNEFMPAKEVINRIKHDV 425 Query: 71 RACVGSWRHVTRNKQNWSIC 12 + R + R + + S+C Sbjct: 426 ALKLWLGRKLKRCEWHHSLC 445 >GAV58865.1 zf-RVT domain-containing protein [Cephalotus follicularis] Length = 149 Score = 58.2 bits (139), Expect = 9e-09 Identities = 27/80 (33%), Positives = 46/80 (57%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W DEV+W++ G+ F S +R L ++YHIWL RNR+ F++E + I+++ DV Sbjct: 62 WSDEVQWMLDHVRGQKFPSFVRKLAFAASVYHIWLERNRRCFKNEFTPAKEIINRIKHDV 121 Query: 71 RACVGSWRHVTRNKQNWSIC 12 + R + R + + S+C Sbjct: 122 ALKLWLGRKLQRCEWHHSLC 141 >GAV92516.1 hypothetical protein CFOL_v3_35895 [Cephalotus follicularis] Length = 101 Score = 57.0 bits (136), Expect = 1e-08 Identities = 24/82 (29%), Positives = 44/82 (53%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W DEV+W+ G +F + L+ L + +YHIWL NR+ F++ IV K DV Sbjct: 16 WSDEVQWMTGHTKGNNFPASLKKLAFVATVYHIWLETNRRCFKNSFLPFQEIVRKVCFDV 75 Query: 71 RACVGSWRHVTRNKQNWSICTD 6 + + + +++++ S+C + Sbjct: 76 AGKLSICKKIQKSERHHSLCVN 97 >GAV85209.1 zf-RVT domain-containing protein [Cephalotus follicularis] Length = 451 Score = 60.1 bits (144), Expect = 1e-08 Identities = 27/82 (32%), Positives = 47/82 (57%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W DEV+W++ G+ F S +R L ++YHIWL RNR+ F++E + I+++ DV Sbjct: 364 WSDEVQWMLDHARGQKFPSLVRKLAFAASVYHIWLERNRRCFKNEFTPAKEIINRIKHDV 423 Query: 71 RACVGSWRHVTRNKQNWSICTD 6 + R + R + + S+C + Sbjct: 424 ALKLWLGRKLQRCEWHHSLCVN 445 >GAV58142.1 zf-RVT domain-containing protein [Cephalotus follicularis] Length = 493 Score = 60.1 bits (144), Expect = 1e-08 Identities = 28/80 (35%), Positives = 45/80 (56%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W DEV+W++ GK F S +R L ++YHIWL RNR+ F++E + I++ DV Sbjct: 406 WSDEVQWMLDHAKGKKFPSLVRKLAFAASLYHIWLERNRRCFKNEFMPAKEIINMIKHDV 465 Query: 71 RACVGSWRHVTRNKQNWSIC 12 + R + R + + S+C Sbjct: 466 SLKLWLGRKLQRCEWHHSLC 485 >GAV76619.1 zf-RVT domain-containing protein [Cephalotus follicularis] Length = 149 Score = 57.8 bits (138), Expect = 1e-08 Identities = 26/80 (32%), Positives = 45/80 (56%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W DEV+W++ G+ F S +R L ++YHIWL RNR+ F++E I+++ D+ Sbjct: 62 WSDEVQWMLDHARGQKFPSLVRKLAFAASVYHIWLERNRRCFKNEFMPVKEIINRIKHDM 121 Query: 71 RACVGSWRHVTRNKQNWSIC 12 + R + R + + S+C Sbjct: 122 ALKLWLGRKLQRCEWHHSLC 141 >GAV66547.1 hypothetical protein CFOL_v3_10057 [Cephalotus follicularis] Length = 115 Score = 56.2 bits (134), Expect = 3e-08 Identities = 23/82 (28%), Positives = 47/82 (57%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W +EV+W+++ G F +R L + IYHIWL RNR+ F + ++ I+ K +V Sbjct: 34 WMEEVQWMIEHKKGNKFSEMVRKLALAATIYHIWLERNRRCFNNLFLHAQEIIRKITQEV 93 Query: 71 RACVGSWRHVTRNKQNWSICTD 6 + + ++ R++++ ++C + Sbjct: 94 AWKIYTVGNILRSERHHNLCVN 115 >XP_019261681.1 PREDICTED: uncharacterized protein LOC109239557 [Nicotiana attenuata] Length = 464 Score = 58.9 bits (141), Expect = 3e-08 Identities = 26/74 (35%), Positives = 41/74 (55%) Frame = -2 Query: 254 GWEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVD 75 GW E++W ++ G K+ L LC+ +YHIWL RNR+ F+ +++S I + V D Sbjct: 383 GWNGEIKWAIEHVKGNGSKTMLYRLCMTGVVYHIWLERNRRLFQKIKRSSEDITRQIVRD 442 Query: 74 VRACVGSWRHVTRN 33 + C+G RN Sbjct: 443 IH-CIGYSHSRLRN 455 >GAV73542.1 zf-RVT domain-containing protein [Cephalotus follicularis] Length = 152 Score = 57.0 bits (136), Expect = 3e-08 Identities = 27/80 (33%), Positives = 44/80 (55%) Frame = -2 Query: 251 WEDEVRWLVQKGMGKSFKSRLRSLCIINAIYHIWLSRNRKHFEDEEQNSNSIVSKSVVDV 72 W DEV+W++ G F + +R L +IYHIWL RNR+ F++E + IV + DV Sbjct: 62 WTDEVQWMLDHARGHKFPALVRKLAFAASIYHIWLERNRRCFKNEFMPAQEIVDRIKHDV 121 Query: 71 RACVGSWRHVTRNKQNWSIC 12 + + + R + + S+C Sbjct: 122 ASKLWLGQKTQRCEWHHSLC 141