BLASTX nr result
ID: Lithospermum23_contig00027384
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00027384 (386 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP13684.1 unnamed protein product [Coffea canephora] 75 3e-13 XP_012841829.1 PREDICTED: farnesyl pyrophosphate synthase-like [... 69 3e-11 XP_018813512.1 PREDICTED: farnesyl pyrophosphate synthase 1-like... 69 3e-11 XP_016439077.1 PREDICTED: farnesyl pyrophosphate synthase 1-like... 69 3e-11 XP_009594047.1 PREDICTED: farnesyl pyrophosphate synthase 1-like... 69 3e-11 ADO95193.1 farnesyl diphosphate synthase [Catharanthus roseus] 69 3e-11 ACD54843.1 farnesyl pyrophosphate syntethase, partial [Olea euro... 66 7e-11 XP_004248322.3 PREDICTED: farnesyl pyrophosphate synthase 1-like... 68 7e-11 KCW75065.1 hypothetical protein EUGRSUZ_E038362, partial [Eucaly... 65 8e-11 XP_011097731.1 PREDICTED: farnesyl pyrophosphate synthase-like [... 68 8e-11 AIU80188.1 farnesyl pyrophosphate synthase [Chlorophytum borivil... 68 8e-11 ABQ53941.1 farnesylpyrophosphate synthase, partial [Nicotiana at... 64 1e-10 XP_004293412.1 PREDICTED: farnesyl pyrophosphate synthase 1 [Fra... 67 2e-10 KCW75063.1 hypothetical protein EUGRSUZ_E03835 [Eucalyptus grandis] 65 2e-10 BAA88844.1 Farnesyl pyrophosphate synthase [Gentiana lutea] ACF2... 67 2e-10 NP_001312538.1 farnesyl pyrophosphate synthase 1-like [Nicotiana... 67 2e-10 XP_009759138.1 PREDICTED: farnesyl pyrophosphate synthase 1-like... 67 2e-10 KCW75064.1 hypothetical protein EUGRSUZ_E03835 [Eucalyptus grandis] 65 2e-10 XP_018837397.1 PREDICTED: farnesyl pyrophosphate synthase 1-like... 66 3e-10 AIG15449.1 farnesyl diphosphate synthase [Azadirachta indica] 66 3e-10 >CDP13684.1 unnamed protein product [Coffea canephora] Length = 342 Score = 74.7 bits (182), Expect = 3e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -3 Query: 384 DVYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 DV+LEYERKSYEKLN+ IEAHPS+AVQAVLKSFL+KIYKR K Sbjct: 301 DVFLEYERKSYEKLNKGIEAHPSKAVQAVLKSFLSKIYKRQK 342 >XP_012841829.1 PREDICTED: farnesyl pyrophosphate synthase-like [Erythranthe guttata] EYU33721.1 hypothetical protein MIMGU_mgv1a008270mg [Erythranthe guttata] Length = 379 Score = 69.3 bits (168), Expect = 3e-11 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = -3 Query: 384 DVYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 DVYLEYE SYEK+ IEAHPSR VQAVLKSFLAKIYKR K Sbjct: 338 DVYLEYESTSYEKITNSIEAHPSREVQAVLKSFLAKIYKRQK 379 >XP_018813512.1 PREDICTED: farnesyl pyrophosphate synthase 1-like [Juglans regia] XP_018813518.1 PREDICTED: farnesyl pyrophosphate synthase 1-like [Juglans regia] Length = 342 Score = 68.9 bits (167), Expect = 3e-11 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 381 VYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 V+ EYE KSYEKL + IEAHPS+AVQAVLKSFLAKIYKRLK Sbjct: 302 VFAEYESKSYEKLVKSIEAHPSKAVQAVLKSFLAKIYKRLK 342 >XP_016439077.1 PREDICTED: farnesyl pyrophosphate synthase 1-like [Nicotiana tabacum] Length = 342 Score = 68.9 bits (167), Expect = 3e-11 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -3 Query: 384 DVYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 DVYLEYE+K+YEKL IEA PS+AVQAVLKSFLAKIYKR K Sbjct: 301 DVYLEYEKKTYEKLINSIEAQPSKAVQAVLKSFLAKIYKRQK 342 >XP_009594047.1 PREDICTED: farnesyl pyrophosphate synthase 1-like [Nicotiana tomentosiformis] Length = 342 Score = 68.9 bits (167), Expect = 3e-11 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -3 Query: 384 DVYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 DVYLEYE+K+YEKL IEA PS+AVQAVLKSFLAKIYKR K Sbjct: 301 DVYLEYEKKTYEKLINSIEAQPSKAVQAVLKSFLAKIYKRQK 342 >ADO95193.1 farnesyl diphosphate synthase [Catharanthus roseus] Length = 345 Score = 68.9 bits (167), Expect = 3e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 381 VYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 V+ EYERKSYEKL IEAHPS+AVQAVLKSFLAKIYKR K Sbjct: 305 VFEEYERKSYEKLTSSIEAHPSKAVQAVLKSFLAKIYKRQK 345 >ACD54843.1 farnesyl pyrophosphate syntethase, partial [Olea europaea] Length = 190 Score = 66.2 bits (160), Expect = 7e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -3 Query: 384 DVYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 D YLEYE KSYEK+ + IEA PS+ VQAVLKSFLAKIYKR K Sbjct: 149 DTYLEYESKSYEKITKSIEAQPSKEVQAVLKSFLAKIYKRQK 190 >XP_004248322.3 PREDICTED: farnesyl pyrophosphate synthase 1-like [Solanum lycopersicum] Length = 404 Score = 68.2 bits (165), Expect = 7e-11 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -3 Query: 384 DVYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 DVYLEYER +YEKL IEA PS+AVQAVLKSFLAKIYKR K Sbjct: 363 DVYLEYERSTYEKLINSIEAQPSKAVQAVLKSFLAKIYKRQK 404 >KCW75065.1 hypothetical protein EUGRSUZ_E038362, partial [Eucalyptus grandis] Length = 161 Score = 65.5 bits (158), Expect = 8e-11 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -3 Query: 381 VYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 V+ EYE KSYEKL IEAHPS+AVQAVLKSFL KIYKR K Sbjct: 121 VFAEYESKSYEKLTTSIEAHPSKAVQAVLKSFLGKIYKRQK 161 >XP_011097731.1 PREDICTED: farnesyl pyrophosphate synthase-like [Sesamum indicum] Length = 342 Score = 67.8 bits (164), Expect = 8e-11 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 384 DVYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKR 265 D YLEYER SYEK+ IEAHPS+AVQAVLKSFL KIYKR Sbjct: 301 DAYLEYERTSYEKITNSIEAHPSKAVQAVLKSFLEKIYKR 340 >AIU80188.1 farnesyl pyrophosphate synthase [Chlorophytum borivilianum] Length = 342 Score = 67.8 bits (164), Expect = 8e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 381 VYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 V+LEYE KSYEKL IEAHPS+AVQAVLKSFLAKIYKR K Sbjct: 302 VFLEYESKSYEKLITSIEAHPSKAVQAVLKSFLAKIYKRQK 342 >ABQ53941.1 farnesylpyrophosphate synthase, partial [Nicotiana attenuata] Length = 116 Score = 63.9 bits (154), Expect = 1e-10 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 384 DVYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKR 265 +V+LEYE+KSYEKL I AHPS+AVQAVL SFL KIYKR Sbjct: 76 EVFLEYEKKSYEKLTSSIAAHPSKAVQAVLHSFLGKIYKR 115 >XP_004293412.1 PREDICTED: farnesyl pyrophosphate synthase 1 [Fragaria vesca subsp. vesca] Length = 342 Score = 67.0 bits (162), Expect = 2e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 381 VYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 V+ EYER+SYEKL IEAHPS+AVQ VLKSFL KIYKRLK Sbjct: 302 VFAEYERQSYEKLTSSIEAHPSKAVQEVLKSFLGKIYKRLK 342 >KCW75063.1 hypothetical protein EUGRSUZ_E03835 [Eucalyptus grandis] Length = 200 Score = 65.5 bits (158), Expect = 2e-10 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -3 Query: 381 VYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 V+ EYE KSYEKL IEAHPS+AVQAVLKSFL KIYKR K Sbjct: 160 VFAEYESKSYEKLTTSIEAHPSKAVQAVLKSFLGKIYKRQK 200 >BAA88844.1 Farnesyl pyrophosphate synthase [Gentiana lutea] ACF21779.1 farnesyl pyrophosphate synthase [Gentiana lutea] Length = 349 Score = 67.0 bits (162), Expect = 2e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -3 Query: 381 VYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 V+ E+E KSYEKLN IEAHP++AVQAVLKSFL KIYKRLK Sbjct: 309 VFKEFESKSYEKLNTSIEAHPNKAVQAVLKSFLGKIYKRLK 349 >NP_001312538.1 farnesyl pyrophosphate synthase 1-like [Nicotiana tabacum] AHM22931.1 farnesyl pyrophosphate synthase 1 [Nicotiana tabacum] Length = 341 Score = 66.6 bits (161), Expect = 2e-10 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -3 Query: 384 DVYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 DVYLEYE+ +YEKL IEA PS+AVQAVLKSFLAKIYKR K Sbjct: 300 DVYLEYEKTTYEKLINSIEAQPSKAVQAVLKSFLAKIYKRQK 341 >XP_009759138.1 PREDICTED: farnesyl pyrophosphate synthase 1-like [Nicotiana sylvestris] XP_016473970.1 PREDICTED: farnesyl pyrophosphate synthase 1-like [Nicotiana tabacum] Length = 342 Score = 66.6 bits (161), Expect = 2e-10 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -3 Query: 384 DVYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 DVYLEYE+ +YEKL IEA PS+AVQAVLKSFLAKIYKR K Sbjct: 301 DVYLEYEKTTYEKLINSIEAQPSKAVQAVLKSFLAKIYKRQK 342 >KCW75064.1 hypothetical protein EUGRSUZ_E03835 [Eucalyptus grandis] Length = 227 Score = 65.5 bits (158), Expect = 2e-10 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -3 Query: 381 VYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 V+ EYE KSYEKL IEAHPS+AVQAVLKSFL KIYKR K Sbjct: 187 VFAEYESKSYEKLTTSIEAHPSKAVQAVLKSFLGKIYKRQK 227 >XP_018837397.1 PREDICTED: farnesyl pyrophosphate synthase 1-like [Juglans regia] Length = 342 Score = 66.2 bits (160), Expect = 3e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 381 VYLEYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 V+ EYERKSYEKL IEAHPS+AVQAVLKSFL KIY+R K Sbjct: 302 VFAEYERKSYEKLTASIEAHPSKAVQAVLKSFLGKIYQRQK 342 >AIG15449.1 farnesyl diphosphate synthase [Azadirachta indica] Length = 342 Score = 66.2 bits (160), Expect = 3e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -3 Query: 372 EYERKSYEKLNEEIEAHPSRAVQAVLKSFLAKIYKRLK 259 EYER+SYEKL + IEAHPS+AVQAVLKSFLAKIYKR K Sbjct: 305 EYERESYEKLTKSIEAHPSKAVQAVLKSFLAKIYKRQK 342