BLASTX nr result
ID: Lithospermum23_contig00027314
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00027314 (293 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019159336.1 PREDICTED: protein RKD2 [Ipomoea nil] 54 2e-06 >XP_019159336.1 PREDICTED: protein RKD2 [Ipomoea nil] Length = 282 Score = 54.3 bits (129), Expect = 2e-06 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = -1 Query: 236 SLSDLRNKAVKQGKAALKLGVYRGHGINKLD---RSTLVQIFKSHWEHQY 96 SLSDLR +A K+GK AL+LGVYR H + KLD R L+Q+FKS + Q+ Sbjct: 230 SLSDLREQAAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW 279