BLASTX nr result
ID: Lithospermum23_contig00026938
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00026938 (285 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009786144.1 PREDICTED: branchpoint-bridging protein-like [Nic... 52 7e-06 XP_016488136.1 PREDICTED: proline-rich receptor-like protein kin... 52 8e-06 >XP_009786144.1 PREDICTED: branchpoint-bridging protein-like [Nicotiana sylvestris] XP_016515454.1 PREDICTED: branchpoint-bridging protein-like [Nicotiana tabacum] Length = 189 Score = 51.6 bits (122), Expect = 7e-06 Identities = 25/52 (48%), Positives = 30/52 (57%) Frame = -2 Query: 158 LESISRKMLIFLLCCMFFRVNSQXXXXXXXXXTGMLCISECETCPALCSPPP 3 L I+ K I LLC F + NSQ G+LCIS+C TCP +CSPPP Sbjct: 9 LALITTKWSILLLCVTFSQANSQETNNNTQA--GLLCISDCSTCPVICSPPP 58 >XP_016488136.1 PREDICTED: proline-rich receptor-like protein kinase PERK2 [Nicotiana tabacum] Length = 194 Score = 51.6 bits (122), Expect = 8e-06 Identities = 24/52 (46%), Positives = 31/52 (59%) Frame = -2 Query: 158 LESISRKMLIFLLCCMFFRVNSQXXXXXXXXXTGMLCISECETCPALCSPPP 3 L ++ K I LLC +F + NSQ G+LCIS+C TCP +CSPPP Sbjct: 9 LAMMTTKWSILLLCVIFSQANSQDPNNNNTPA-GLLCISDCSTCPVICSPPP 59