BLASTX nr result
ID: Lithospermum23_contig00026814
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00026814 (665 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAN65208.1 putative syntaxin, partial [Gossypioides kirkii] 54 5e-06 AAN65207.1 putative syntaxin, partial [Gossypium barbadense] 53 9e-06 >AAN65208.1 putative syntaxin, partial [Gossypioides kirkii] Length = 94 Score = 53.5 bits (127), Expect = 5e-06 Identities = 27/57 (47%), Positives = 37/57 (64%), Gaps = 3/57 (5%) Frame = -2 Query: 487 ESPLPDSHIIEMTN---TDGSPNLDMMLVYMETIKDEIRLLERNHDELQSAHQKSST 326 E PD H+IEMT T G NLD +E+IKDE++ LER +D+L S+H++S T Sbjct: 15 EEASPDHHVIEMTQSSPTSGGVNLDKFFEDVESIKDELKELERLNDDLSSSHERSKT 71 >AAN65207.1 putative syntaxin, partial [Gossypium barbadense] Length = 94 Score = 52.8 bits (125), Expect = 9e-06 Identities = 26/57 (45%), Positives = 38/57 (66%), Gaps = 3/57 (5%) Frame = -2 Query: 487 ESPLPDSHIIEMT---NTDGSPNLDMMLVYMETIKDEIRLLERNHDELQSAHQKSST 326 E PD H+IEMT +T G NLD +E+IKDE++ LER +D+L ++H++S T Sbjct: 15 EEASPDHHVIEMTQSSSTSGGVNLDKFFEDVESIKDELKELERLNDDLSASHERSKT 71