BLASTX nr result
ID: Lithospermum23_contig00026704
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00026704 (286 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018630892.1 PREDICTED: uncharacterized protein LOC108947416 [... 135 5e-39 XP_013442820.1 ribosomal protein S12C [Medicago truncatula] KEH1... 139 3e-38 YP_588353.1 ribosomal protein S12 (mitochondrion) [Zea mays subs... 124 6e-35 YP_009306100.1 ribosomal protein S12 (mitochondrion) [Corchorus ... 122 5e-34 CDM82787.1 unnamed protein product [Triticum aestivum] 122 5e-34 Q95869.1 RecName: Full=Ribosomal protein S12, mitochondrial CAA6... 122 5e-34 YP_398424.1 ribosomal protein S12 (mitochondrion) [Triticum aest... 122 5e-34 YP_003587241.1 ribosomal protein S12 [Citrullus lanatus] ACV9664... 122 6e-34 Q96033.1 RecName: Full=Ribosomal protein S12, mitochondrial CAA8... 122 6e-34 YP_008802516.1 ribosomal protein S12 (mitochondrion) [Asclepias ... 122 6e-34 YP_005090462.1 ribosomal protein S12 (mitochondrion) [Millettia ... 122 6e-34 ANS54546.1 ribosomal protein S12 (mitochondrion) [Cynomorium coc... 122 7e-34 NP_064075.2 rps12 gene product (mitochondrion) [Beta vulgaris su... 121 9e-34 YP_514650.1 ribosomal protein S12 (mitochondrion) [Oryza sativa ... 120 2e-33 YP_003587377.1 ribosomal protein S12 [Cucurbita pepo] ACV96691.1... 120 2e-33 YP_009316388.1 ribosomal protein S12 (mitochondrion) [Castilleja... 120 3e-33 YP_009173845.1 ribosomal protein S12 (mitochondrion) [Populus tr... 120 3e-33 AGL75403.1 ribosomal protein S12 (mitochondrion) [Utricularia gi... 120 3e-33 AAD03039.1 ribosomal protein S12 (mitochondrion) [Solanum tubero... 119 5e-33 YP_009295080.1 ribosomal protein S12 (mitochondrion) [Ipomoea ni... 119 5e-33 >XP_018630892.1 PREDICTED: uncharacterized protein LOC108947416 [Nicotiana tomentosiformis] Length = 142 Score = 135 bits (340), Expect = 5e-39 Identities = 65/70 (92%), Positives = 67/70 (95%) Frame = +3 Query: 75 GGRTKERAMPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKI 254 GGRTKERAMPT NQLIRHGREEKRRTDRTRALDQCPQKQGVC RVSTRTPKKPNSA RKI Sbjct: 10 GGRTKERAMPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCPRVSTRTPKKPNSAPRKI 69 Query: 255 AKVRLTNKHD 284 AKVRL+N+HD Sbjct: 70 AKVRLSNRHD 79 >XP_013442820.1 ribosomal protein S12C [Medicago truncatula] KEH16845.1 ribosomal protein S12C [Medicago truncatula] Length = 362 Score = 139 bits (351), Expect = 3e-38 Identities = 71/89 (79%), Positives = 74/89 (83%) Frame = +3 Query: 18 LGSLYEWKRGASDTSDRAKGGRTKERAMPTKNQLIRHGREEKRRTDRTRALDQCPQKQGV 197 +GSLYEWKRG GGRTKERAMPT NQLIRHGREEKRRTDRTRA DQCPQKQGV Sbjct: 220 IGSLYEWKRG---------GGRTKERAMPTLNQLIRHGREEKRRTDRTRASDQCPQKQGV 270 Query: 198 CLRVSTRTPKKPNSAQRKIAKVRLTNKHD 284 RV RTPKKPNSAQRKIAKVRL+N+HD Sbjct: 271 RPRVFKRTPKKPNSAQRKIAKVRLSNRHD 299 >YP_588353.1 ribosomal protein S12 (mitochondrion) [Zea mays subsp. mays] P60098.1 RecName: Full=Ribosomal protein S12, mitochondrial P60099.1 RecName: Full=Ribosomal protein S12, mitochondrial AAR91117.1 ribosomal protein S12 (mitochondrion) [Zea mays] Length = 125 Score = 124 bits (312), Expect = 6e-35 Identities = 59/62 (95%), Positives = 61/62 (98%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSA RKIAKVRL+N+ Sbjct: 1 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSALRKIAKVRLSNR 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >YP_009306100.1 ribosomal protein S12 (mitochondrion) [Corchorus capsularis] AOO95938.1 ribosomal protein S12 (mitochondrion) [Corchorus capsularis] Length = 125 Score = 122 bits (306), Expect = 5e-34 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPTKNQLIRHGREEKRRTDRTRA DQCPQKQGVCLRVSTRTPKKPNSA RKIAKVRL+N+ Sbjct: 1 MPTKNQLIRHGREEKRRTDRTRASDQCPQKQGVCLRVSTRTPKKPNSALRKIAKVRLSNR 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >CDM82787.1 unnamed protein product [Triticum aestivum] Length = 125 Score = 122 bits (306), Expect = 5e-34 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPTKNQLIRHGREEKRRTDRTRA DQCPQKQGVCLRVSTRTPKKPNSA RKIAKVRL+N+ Sbjct: 1 MPTKNQLIRHGREEKRRTDRTRASDQCPQKQGVCLRVSTRTPKKPNSALRKIAKVRLSNR 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >Q95869.1 RecName: Full=Ribosomal protein S12, mitochondrial CAA65515.1 ribosomal protein S12 (mitochondrion) [Nicotiana sylvestris] Length = 125 Score = 122 bits (306), Expect = 5e-34 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVC RVSTRTPKKPNSA RKIAKVRL+N+ Sbjct: 1 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCPRVSTRTPKKPNSAPRKIAKVRLSNR 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >YP_398424.1 ribosomal protein S12 (mitochondrion) [Triticum aestivum] YP_740364.1 ribosomal protein S12 (mitochondrion) [Zea perennis] YP_740443.1 ribosomal protein S12 (mitochondrion) [Zea luxurians] YP_740387.1 ribosomal protein S12 (mitochondrion) [Zea mays subsp. parviglumis] YP_762329.1 ribosomal protein S12 (mitochondrion) [Sorghum bicolor] YP_762509.1 ribosomal protein S12 (mitochondrion) [Tripsacum dactyloides] YP_008757376.1 ribosomal protein small subunit 12 (mitochondrion) [Aegilops speltoides] YP_008758142.1 ribosomal protein small subunit 12 (mitochondrion) [Triticum timopheevii] pir||R3ZM12 ribosomal protein S12 - maize mitochondrion AAD37353.1 ribosomal protein S12 (mitochondrion) [Aegilops tauschii] AAG22494.1 ribosomal protein small subunit (mitochondrion) [Coix lacryma-jobi] CAA32476.1 unnamed protein product (mitochondrion) [Triticum aestivum] CAA32834.1 unnamed protein product (mitochondrion) [Zea mays] CAA41865.1 ribosomal protein S12 (mitochondrion) [Triticum aestivum] CAB06624.1 mitochondrial rps12 [Sorghum bicolor] CAA73770.1 ribosomal protein S12 (mitochondrion) [Sorghum bicolor] CAC19842.1 ribosomal protein subunit 12s (mitochondrion) [Avena sativa] BAE47691.1 rps12 (mitochondrion) [Triticum aestivum] ABE98689.1 ribosomal protein S12 (mitochondrion) [Zea mays subsp. mays] ABE98733.1 ribosomal protein S12 (mitochondrion) [Zea mays subsp. mays] ABE98780.1 ribosomal protein S12 (mitochondrion) [Zea mays subsp. mays] ABF70835.1 ribosomal protein S12 (mitochondrion) [Zea perennis] ABF70867.1 ribosomal protein S12 (mitochondrion) [Zea mays subsp. parviglumis] ABF70929.1 ribosomal protein S12 (mitochondrion) [Zea mays subsp. mays] ABG65658.1 ribosomal protein S12 (mitochondrion) [Zea luxurians] ABI60890.1 ribosomal protein S12 (mitochondrion) [Sorghum bicolor] ABI74662.1 ribosomal protein S12 (mitochondrion) [Tripsacum dactyloides] ABY55194.1 ribosomal protein S12 (mitochondrion) [Bambusa oldhamii] ACA62636.1 rps12 (mitochondrion) [Triticum aestivum] ADE08104.1 rps12 (mitochondrion) [Triticum aestivum] AEK66743.1 ribosomal protein S12 (mitochondrion) [Ferrocalamus rimosivaginus] EHK62680.1 hypothetical protein M3S_J76 (mitochondrion) [Sorghum bicolor] EHK62684.1 hypothetical protein M3S_E10 (mitochondrion) [Sorghum bicolor] EHK62699.1 hypothetical protein M3S_K13, partial (mitochondrion) [Sorghum bicolor] AEX98105.1 ribosomal protein S12 (mitochondrion) [Ferrocalamus rimosivaginus] AGI48780.1 ribosomal protein S12 (mitochondrion) [Lolium perenne] BAN94703.1 ribosomal protein small subunit 12 (mitochondrion) [Triticum timopheevii] BAN94755.1 ribosomal protein small subunit 12 (mitochondrion) [Aegilops speltoides] AHI16354.1 rps12 (mitochondrion) [Aegilops longissima] AHI16383.1 rps12 (mitochondrion) [Triticum turgidum subsp. durum] AHI16410.1 rps12 (mitochondrion) [Triticum turgidum subsp. durum] KQK85816.1 hypothetical protein SETIT_020787mg [Setaria italica] ANI86450.1 ribosomal protein S12 (mitochondrion) [Hordeum vulgare subsp. vulgare] BAV56940.1 ribosomal protein S12 (mitochondrion) [Saccharum officinarum] BAV58104.1 ribosomal protein small subunit 12 (mitochondrion) [Hordeum vulgare subsp. spontaneum] BAV58138.1 ribosomal protein small subunit 12 (mitochondrion) [Hordeum vulgare subsp. vulgare] Length = 125 Score = 122 bits (306), Expect = 5e-34 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPTKNQLIRHGREEKRRTDRTRA DQCPQKQGVCLRVSTRTPKKPNSA RKIAKVRL+N+ Sbjct: 1 MPTKNQLIRHGREEKRRTDRTRASDQCPQKQGVCLRVSTRTPKKPNSALRKIAKVRLSNR 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >YP_003587241.1 ribosomal protein S12 [Citrullus lanatus] ACV96648.1 ribosomal protein S12 (mitochondrion) [Citrullus lanatus] Length = 123 Score = 122 bits (305), Expect = 6e-34 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPT NQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSA RKIAKVRL+N+ Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSALRKIAKVRLSNR 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >Q96033.1 RecName: Full=Ribosomal protein S12, mitochondrial CAA89857.1 ribosomal protein S12 (mitochondrion) [Helianthus annuus] Length = 125 Score = 122 bits (305), Expect = 6e-34 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPT NQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSA RKIAKVRL+N+ Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSALRKIAKVRLSNR 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >YP_008802516.1 ribosomal protein S12 (mitochondrion) [Asclepias syriaca] AGZ63050.1 ribosomal protein S12 (mitochondrion) (mitochondrion) [Asclepias syriaca] Length = 125 Score = 122 bits (305), Expect = 6e-34 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPT NQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSA RKIAKVRL+N+ Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSALRKIAKVRLSNR 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >YP_005090462.1 ribosomal protein S12 (mitochondrion) [Millettia pinnata] YP_005090500.1 ribosomal protein S12 (mitochondrion) [Lotus japonicus] YP_008999593.1 ribosomal protein S12 (mitochondrion) [Vaccinium macrocarpon] BAD83444.2 ribosomal protein S12 (mitochondrion) [Nicotiana tabacum] AET62922.1 ribosomal protein S12 (mitochondrion) [Millettia pinnata] AET62960.1 ribosomal protein S12 (mitochondrion) [Lotus japonicus] AGX28807.1 ribosomal protein S12 (mitochondrion) [Vaccinium macrocarpon] Length = 125 Score = 122 bits (305), Expect = 6e-34 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPT NQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSA RKIAKVRL+N+ Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSALRKIAKVRLSNR 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >ANS54546.1 ribosomal protein S12 (mitochondrion) [Cynomorium coccineum] Length = 126 Score = 122 bits (305), Expect = 7e-34 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPT NQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSA RKIAKVRL+N+ Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSALRKIAKVRLSNR 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >NP_064075.2 rps12 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] YP_004222313.1 ribosomal protein S12 (mitochondrion) [Beta vulgaris subsp. maritima] YP_004842119.1 ribosomal protein S12 (mitochondrion) [Beta macrocarpa] ABD36073.1 ribosomal protein S12 (mitochondrion) [Beta vulgaris subsp. vulgaris] BAA99468.2 ribosomal protein S12 (mitochondrion) [Beta vulgaris subsp. vulgaris] CBJ14048.1 ribosomal protein S12 (mitochondrion) [Beta vulgaris subsp. maritima] CBJ17539.1 ribosomal protein S12 (mitochondrion) [Beta vulgaris subsp. maritima] CBJ23366.1 ribosomal protein S12 (mitochondrion) [Beta vulgaris subsp. maritima] CBX24923.1 ribosomal protein S12 (mitochondrion) [Beta macrocarpa] CBL51997.1 ribosomal protein S12 (mitochondrion) [Beta vulgaris subsp. maritima] Length = 125 Score = 121 bits (304), Expect = 9e-34 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPT NQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSA RKIAKVRL+N+ Sbjct: 1 MPTINQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSALRKIAKVRLSNR 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >YP_514650.1 ribosomal protein S12 (mitochondrion) [Oryza sativa Indica Group] YP_002000567.1 ribosomal protein S12 (mitochondrion) [Oryza sativa Japonica Group] YP_003433843.1 ribosomal protein small subunit 12 (mitochondrion) [Oryza rufipogon] YP_009241988.1 ribosomal protein S12 (mitochondrion) [Oryza minuta] YP_009242007.1 ribosomal protein S12 (mitochondrion) [Oryza minuta] P28520.1 RecName: Full=Ribosomal protein S12, mitochondrial BAA06831.1 ribosomal protein S12 (mitochondrion) [Oryza sativa Japonica Group] BAA04795.1 ribosomal protein S12 (mitochondrion) [Oryza sativa Japonica Group] AAA70314.1 ribosomal protein S12 (mitochondrion) [Oryza sativa] BAC19872.1 Ribosomal protein S12 (mitochondrion) [Oryza sativa Japonica Group] AAZ99246.1 ribosomal protein S12 (mitochondrion) [Oryza sativa Indica Group] AAZ99300.1 ribosomal protein S12 (mitochondrion) [Oryza sativa Japonica Group] AAZ99353.1 ribosomal protein S12 (mitochondrion) [Oryza sativa Japonica Group] BAI67947.1 ribosomal protein small subunit 12 (mitochondrion) [Oryza rufipogon] BAI68008.1 ribosomal protein small subunit 12 (mitochondrion) [Oryza sativa Indica Group] AER13027.1 ribosomal protein S12 (mitochondrion) [Oryza sativa Indica Group] AER13099.1 ribosomal protein S12 (mitochondrion) [Oryza sativa Indica Group] AEZ03700.1 ribosomal protein S12 (mitochondrion) [Oryza sativa Indica Group] AEZ03805.1 ribosomal protein S12 (mitochondrion) [Oryza sativa Indica Group] BAN67499.1 ribosomal protein small subunit 12 (mitochondrion) [Oryza rufipogon] BAN67531.1 ribosomal protein small subunit 12 (mitochondrion) [Oryza rufipogon] AMA06707.1 ribosomal protein S12 (mitochondrion) [Oryza minuta] AMA06724.1 ribosomal protein S12 (mitochondrion) [Oryza minuta] BAV53198.1 ribosomal protein small subunit 12 (mitochondrion) [Oryza sativa Indica Group] Length = 125 Score = 120 bits (302), Expect = 2e-33 Identities = 57/62 (91%), Positives = 60/62 (96%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPTKNQLIRHGREEK+RTDRTRA DQCPQKQGVCLRVSTRTPKKPNSA RKIAKVRL+N+ Sbjct: 1 MPTKNQLIRHGREEKQRTDRTRASDQCPQKQGVCLRVSTRTPKKPNSALRKIAKVRLSNR 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >YP_003587377.1 ribosomal protein S12 [Cucurbita pepo] ACV96691.1 ribosomal protein S12 (mitochondrion) [Cucurbita pepo] Length = 125 Score = 120 bits (302), Expect = 2e-33 Identities = 57/62 (91%), Positives = 60/62 (96%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPT NQLIRHGREEKRRTDRTRALDQCPQKQGVCLR+STRTPKKPNSA RKIAKVRL+N+ Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRLSTRTPKKPNSALRKIAKVRLSNR 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >YP_009316388.1 ribosomal protein S12 (mitochondrion) [Castilleja paramensis] AKQ51048.1 ribosomal protein subunit S12 (mitochondrion) [Bartsia sp. JPM2059] ANJ04348.1 ribosomal protein S12 (mitochondrion) [Castilleja paramensis] Length = 125 Score = 120 bits (301), Expect = 3e-33 Identities = 57/62 (91%), Positives = 60/62 (96%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPT NQLIRHGREEKRRTDRTRALDQCPQK+GVCLRVSTRTPKKPNSA RKIAKV+L+NK Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKEGVCLRVSTRTPKKPNSALRKIAKVQLSNK 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >YP_009173845.1 ribosomal protein S12 (mitochondrion) [Populus tremula] YP_009178742.1 ribosomal protein S12 (mitochondrion) [Populus tremula x Populus alba] ALH07317.1 ribosomal protein S12 (mitochondrion) [Populus tremula] ALJ49773.1 ribosomal protein S12 (mitochondrion) [Populus tremula x Populus alba] Length = 125 Score = 120 bits (301), Expect = 3e-33 Identities = 57/62 (91%), Positives = 59/62 (95%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPT NQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSA RKI KVRL+N+ Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSALRKIVKVRLSNR 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >AGL75403.1 ribosomal protein S12 (mitochondrion) [Utricularia gibba] Length = 125 Score = 120 bits (301), Expect = 3e-33 Identities = 57/62 (91%), Positives = 60/62 (96%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPTKNQLIRHGREEKRRTDRTRALDQCPQK+GVC RVSTRTPKKPNSA RKIAKV+L+NK Sbjct: 1 MPTKNQLIRHGREEKRRTDRTRALDQCPQKEGVCPRVSTRTPKKPNSALRKIAKVQLSNK 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >AAD03039.1 ribosomal protein S12 (mitochondrion) [Solanum tuberosum] Length = 123 Score = 119 bits (299), Expect = 5e-33 Identities = 57/62 (91%), Positives = 59/62 (95%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPT NQLIRHGREEKRRTDRTRALDQCPQKQGVC RVSTRTPKKPNSA RKIAKVRL+N+ Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCPRVSTRTPKKPNSAPRKIAKVRLSNR 60 Query: 279 HD 284 HD Sbjct: 61 HD 62 >YP_009295080.1 ribosomal protein S12 (mitochondrion) [Ipomoea nil] BAV56611.1 ribosomal protein S12 (mitochondrion) [Ipomoea nil] Length = 125 Score = 119 bits (299), Expect = 5e-33 Identities = 57/62 (91%), Positives = 59/62 (95%) Frame = +3 Query: 99 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTPKKPNSAQRKIAKVRLTNK 278 MPT NQLIRHGREEKRRTDRTRALDQCPQKQGVC RVSTRTPKKPNSA RKIAKVRL+N+ Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCPRVSTRTPKKPNSAPRKIAKVRLSNR 60 Query: 279 HD 284 HD Sbjct: 61 HD 62