BLASTX nr result
ID: Lithospermum23_contig00026567
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00026567 (209 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH69023.1 hypothetical protein GLYMA_03G264000 [Glycine max] 54 1e-06 XP_003520895.2 PREDICTED: uncharacterized protein LOC100785776 [... 54 1e-06 GAU45658.1 hypothetical protein TSUD_293670 [Trifolium subterran... 52 3e-06 XP_013443012.1 DUF936 family protein [Medicago truncatula] KEH17... 52 3e-06 XP_008464802.1 PREDICTED: uncharacterized protein LOC103502603 i... 51 8e-06 OMO66044.1 hypothetical protein COLO4_30821 [Corchorus olitorius] 51 8e-06 >KRH69023.1 hypothetical protein GLYMA_03G264000 [Glycine max] Length = 506 Score = 53.5 bits (127), Expect = 1e-06 Identities = 23/32 (71%), Positives = 31/32 (96%) Frame = +1 Query: 112 RKMASLIPGVLLKLLESINTNAKIRGEHRSIL 207 R+MASL+PGVLLKLL+S+N+N K+RGE+RS+L Sbjct: 14 RRMASLVPGVLLKLLQSMNSNVKVRGEYRSVL 45 >XP_003520895.2 PREDICTED: uncharacterized protein LOC100785776 [Glycine max] KRH69021.1 hypothetical protein GLYMA_03G264000 [Glycine max] KRH69022.1 hypothetical protein GLYMA_03G264000 [Glycine max] Length = 542 Score = 53.5 bits (127), Expect = 1e-06 Identities = 23/32 (71%), Positives = 31/32 (96%) Frame = +1 Query: 112 RKMASLIPGVLLKLLESINTNAKIRGEHRSIL 207 R+MASL+PGVLLKLL+S+N+N K+RGE+RS+L Sbjct: 14 RRMASLVPGVLLKLLQSMNSNVKVRGEYRSVL 45 >GAU45658.1 hypothetical protein TSUD_293670 [Trifolium subterraneum] Length = 299 Score = 52.4 bits (124), Expect = 3e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 118 MASLIPGVLLKLLESINTNAKIRGEHRSIL 207 MASLIPGVLLKLL+++N+N K+RGEHRS+L Sbjct: 1 MASLIPGVLLKLLQTMNSNVKVRGEHRSVL 30 >XP_013443012.1 DUF936 family protein [Medicago truncatula] KEH17037.1 DUF936 family protein [Medicago truncatula] Length = 533 Score = 52.4 bits (124), Expect = 3e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 118 MASLIPGVLLKLLESINTNAKIRGEHRSIL 207 MASLIPGVLLKLL+++N+N K+RGEHRS+L Sbjct: 1 MASLIPGVLLKLLQTMNSNVKVRGEHRSVL 30 >XP_008464802.1 PREDICTED: uncharacterized protein LOC103502603 isoform X1 [Cucumis melo] Length = 534 Score = 51.2 bits (121), Expect = 8e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 118 MASLIPGVLLKLLESINTNAKIRGEHRSIL 207 MASLIPGVLLKLL+S+N+N K+RGE+RS+L Sbjct: 1 MASLIPGVLLKLLQSMNSNVKVRGEYRSVL 30 >OMO66044.1 hypothetical protein COLO4_30821 [Corchorus olitorius] Length = 542 Score = 51.2 bits (121), Expect = 8e-06 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = +1 Query: 118 MASLIPGVLLKLLESINTNAKIRGEHRSIL 207 MASL+PGVL+KLL+SIN+N K+RGE+RS+L Sbjct: 1 MASLVPGVLIKLLQSINSNVKVRGEYRSVL 30