BLASTX nr result
ID: Lithospermum23_contig00026412
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00026412 (215 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_683610.1 Pol-like polyprotein/retrotransposon [Arabidopsis th... 45 4e-06 >NP_683610.1 Pol-like polyprotein/retrotransposon [Arabidopsis thaliana] AEE77608.1 Pol-like polyprotein/retrotransposon [Arabidopsis thaliana] Length = 109 Score = 45.4 bits (106), Expect(2) = 4e-06 Identities = 21/49 (42%), Positives = 33/49 (67%) Frame = -1 Query: 203 RLSEPLFEKSKEMTIEKWNKLDRKVLEAIRLKLADNVSHNVAKRPQHRG 57 +L +PL +K + M+ + WN L R+VL+ IRL ++ N++HNVAK G Sbjct: 29 KLHQPLGKKVETMSQDDWNILYRQVLDVIRLTISKNIAHNVAKEKSPDG 77 Score = 32.3 bits (72), Expect(2) = 4e-06 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = -3 Query: 78 EKTTTQGAMKVLSDLYEKPTTHNKV 4 ++ + G MKVLSD+Y+KP+T+N V Sbjct: 71 KEKSPDGLMKVLSDIYKKPSTNNTV 95