BLASTX nr result
ID: Lithospermum23_contig00026303
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00026303 (467 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOF76974.1 hypothetical protein OCBIM_22032656mg, partial [Octop... 53 1e-06 >KOF76974.1 hypothetical protein OCBIM_22032656mg, partial [Octopus bimaculoides] Length = 70 Score = 53.1 bits (126), Expect = 1e-06 Identities = 22/51 (43%), Positives = 28/51 (54%) Frame = +3 Query: 171 HLLPSHLHQNLHHPRHQKNGLHQNHLRVHHQRNHYHQVYHLQASPH*HHHQ 323 H P H H+ HH H HQ+H R HH+ +H+H +H Q H HHHQ Sbjct: 12 HRHPHHYHRQNHHHHHHH---HQHHRRCHHRHHHHHHHHHHQHHHHYHHHQ 59