BLASTX nr result
ID: Lithospermum23_contig00026233
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00026233 (711 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_358581.1 hypothetical protein PhapfoPp032 [Phalaenopsis aphro... 79 2e-15 CBI21459.3 unnamed protein product, partial [Vitis vinifera] 74 6e-14 KYP62756.1 hypothetical protein KK1_017304, partial [Cajanus cajan] 58 4e-08 XP_007159454.1 hypothetical protein PHAVU_002G239000g, partial [... 57 1e-07 >YP_358581.1 hypothetical protein PhapfoPp032 [Phalaenopsis aphrodite subsp. formosana] AAW82556.1 hypothetical protein (chloroplast) [Phalaenopsis aphrodite subsp. formosana] Length = 103 Score = 79.0 bits (193), Expect = 2e-15 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = -2 Query: 668 RAIRTRTVDLLGKTDQTDYYQYDLNCFKDPTCTFLHWALSLTDRIIS 528 RAIRTRTVDLLGKT++T YY+ DLNCFKDPTC LHWALS TD IS Sbjct: 57 RAIRTRTVDLLGKTEKTYYYRNDLNCFKDPTCILLHWALSSTDVKIS 103 >CBI21459.3 unnamed protein product, partial [Vitis vinifera] Length = 79 Score = 74.3 bits (181), Expect = 6e-14 Identities = 36/47 (76%), Positives = 39/47 (82%), Gaps = 2/47 (4%) Frame = -2 Query: 701 YNFLNFHGL*F--RAIRTRTVDLLGKTDQTDYYQYDLNCFKDPTCTF 567 ++F F GL + RAIRTRTVDLLGKTDQTDYYQ DLNCFKDPTC F Sbjct: 25 FSFFYFIGLIYYIRAIRTRTVDLLGKTDQTDYYQNDLNCFKDPTCIF 71 >KYP62756.1 hypothetical protein KK1_017304, partial [Cajanus cajan] Length = 54 Score = 58.2 bits (139), Expect = 4e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 668 RAIRTRTVDLLGKTDQTDYYQYDLNCFKDPTCTFL 564 RAIRTRTVDLL KT+QTD YQ DLN FK+PTC F+ Sbjct: 13 RAIRTRTVDLLDKTNQTDSYQNDLNWFKNPTCIFI 47 >XP_007159454.1 hypothetical protein PHAVU_002G239000g, partial [Phaseolus vulgaris] ESW31448.1 hypothetical protein PHAVU_002G239000g, partial [Phaseolus vulgaris] Length = 53 Score = 57.0 bits (136), Expect = 1e-07 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -2 Query: 668 RAIRTRTVDLLGKTDQTDYYQYDLNCFKDPTCTFL 564 RAIRTRTVDLLGKT +T YY D NCF +PTC FL Sbjct: 12 RAIRTRTVDLLGKTAKTHYYLNDFNCFLNPTCIFL 46