BLASTX nr result
ID: Lithospermum23_contig00026232
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00026232 (212 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CBI21459.3 unnamed protein product, partial [Vitis vinifera] 58 2e-09 XP_007159454.1 hypothetical protein PHAVU_002G239000g, partial [... 49 4e-06 KYP62756.1 hypothetical protein KK1_017304, partial [Cajanus cajan] 49 4e-06 >CBI21459.3 unnamed protein product, partial [Vitis vinifera] Length = 79 Score = 57.8 bits (138), Expect = 2e-09 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +3 Query: 42 RAIQT*TVDLLSKTDQTDYYQYDLNCFIYPTCTF 143 RAI+T TVDLL KTDQTDYYQ DLNCF PTC F Sbjct: 38 RAIRTRTVDLLGKTDQTDYYQNDLNCFKDPTCIF 71 >XP_007159454.1 hypothetical protein PHAVU_002G239000g, partial [Phaseolus vulgaris] ESW31448.1 hypothetical protein PHAVU_002G239000g, partial [Phaseolus vulgaris] Length = 53 Score = 48.5 bits (114), Expect = 4e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +3 Query: 42 RAIQT*TVDLLSKTDQTDYYQYDLNCFIYPTCTF 143 RAI+T TVDLL KT +T YY D NCF+ PTC F Sbjct: 12 RAIRTRTVDLLGKTAKTHYYLNDFNCFLNPTCIF 45 >KYP62756.1 hypothetical protein KK1_017304, partial [Cajanus cajan] Length = 54 Score = 48.5 bits (114), Expect = 4e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = +3 Query: 42 RAIQT*TVDLLSKTDQTDYYQYDLNCFIYPTCTF 143 RAI+T TVDLL KT+QTD YQ DLN F PTC F Sbjct: 13 RAIRTRTVDLLDKTNQTDSYQNDLNWFKNPTCIF 46