BLASTX nr result
ID: Lithospermum23_contig00026060
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00026060 (514 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP15351.1 unnamed protein product [Coffea canephora] 50 3e-08 >CDP15351.1 unnamed protein product [Coffea canephora] Length = 817 Score = 49.7 bits (117), Expect(2) = 3e-08 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +2 Query: 272 VQQEFQKLHSLFSQNQTETAKTHLKNLVQSHKVSQLYT 385 +Q++ + L L QN+TETAK HLK L+ SH VSQLYT Sbjct: 56 LQEQLRNLRILLQQNRTETAKRHLKTLIDSHSVSQLYT 93 Score = 35.4 bits (80), Expect(2) = 3e-08 Identities = 15/33 (45%), Positives = 24/33 (72%) Frame = +3 Query: 411 IQTPFFRVPFSLYAQLKSPNEASELYYLLKKDG 509 ++ FF + S+YA+ K P EA+E+Y L+K+DG Sbjct: 103 VKPMFFNMLLSMYAESKRPIEATEVYNLVKEDG 135