BLASTX nr result
ID: Lithospermum23_contig00025916
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00025916 (500 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019255662.1 PREDICTED: QWRF motif-containing protein 2-like [... 58 1e-06 XP_019224839.1 PREDICTED: QWRF motif-containing protein 2-like [... 56 3e-06 XP_015158303.1 PREDICTED: QWRF motif-containing protein 2-like i... 56 3e-06 XP_006362059.1 PREDICTED: QWRF motif-containing protein 2-like i... 56 3e-06 XP_004238098.1 PREDICTED: QWRF motif-containing protein 2 [Solan... 56 3e-06 >XP_019255662.1 PREDICTED: QWRF motif-containing protein 2-like [Nicotiana attenuata] OIS96841.1 qwrf motif-containing protein 2 [Nicotiana attenuata] Length = 709 Score = 57.8 bits (138), Expect = 1e-06 Identities = 38/90 (42%), Positives = 51/90 (56%), Gaps = 6/90 (6%) Frame = +1 Query: 244 KDQLENGKISEVYRWPGRSKAMNSSFLTKSLDFGNDKSKLFGSSNRINDKC------NKG 405 KD+ EN +S+ RWPGR K +NSSFLT+SLD GN+ K FGS + + N G Sbjct: 170 KDRAENSFLSDQQRWPGRLKPVNSSFLTRSLDCGNEIRK-FGSRSVLRSLSKSVIDDNHG 228 Query: 406 VKLKSDSVKGFHAQCVDDNANFGSVLVKSG 495 VK+++ +K + V N N S V SG Sbjct: 229 VKIEA-KLKPQYGNVVKLNVNSDSESVSSG 257 >XP_019224839.1 PREDICTED: QWRF motif-containing protein 2-like [Nicotiana attenuata] OIT33070.1 qwrf motif-containing protein 2 [Nicotiana attenuata] Length = 654 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 7/63 (11%) Frame = +1 Query: 217 ERGRVSSGVK-------DQLENGKISEVYRWPGRSKAMNSSFLTKSLDFGNDKSKLFGSS 375 ERG++++ + D+ EN K S+ +RWPGRSK++NSSFLT+S+D G FGS Sbjct: 187 ERGKIAAAAELLKPVRGDRTENVKPSDQHRWPGRSKSLNSSFLTRSMDCGTTDEPKFGSE 246 Query: 376 NRI 384 + I Sbjct: 247 SVI 249 >XP_015158303.1 PREDICTED: QWRF motif-containing protein 2-like isoform X2 [Solanum tuberosum] Length = 665 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/50 (50%), Positives = 37/50 (74%) Frame = +1 Query: 229 VSSGVKDQLENGKISEVYRWPGRSKAMNSSFLTKSLDFGNDKSKLFGSSN 378 +S+ +D+ EN K S+ +RWPGRSK++NSSFLT+S+D G+ FGS + Sbjct: 205 LSTPARDRTENVKTSDQHRWPGRSKSLNSSFLTRSMDCGSIDKPKFGSGS 254 >XP_006362059.1 PREDICTED: QWRF motif-containing protein 2-like isoform X1 [Solanum tuberosum] XP_006362060.1 PREDICTED: QWRF motif-containing protein 2-like isoform X1 [Solanum tuberosum] Length = 677 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/50 (50%), Positives = 37/50 (74%) Frame = +1 Query: 229 VSSGVKDQLENGKISEVYRWPGRSKAMNSSFLTKSLDFGNDKSKLFGSSN 378 +S+ +D+ EN K S+ +RWPGRSK++NSSFLT+S+D G+ FGS + Sbjct: 217 LSTPARDRTENVKTSDQHRWPGRSKSLNSSFLTRSMDCGSIDKPKFGSGS 266 >XP_004238098.1 PREDICTED: QWRF motif-containing protein 2 [Solanum lycopersicum] Length = 677 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/50 (50%), Positives = 37/50 (74%) Frame = +1 Query: 229 VSSGVKDQLENGKISEVYRWPGRSKAMNSSFLTKSLDFGNDKSKLFGSSN 378 +S+ +D+ EN K S+ +RWPGRSK++NSSFLT+S+D G+ FGS + Sbjct: 217 LSTPARDRTENVKTSDQHRWPGRSKSLNSSFLTRSMDCGSIDKPKFGSGS 266