BLASTX nr result
ID: Lithospermum23_contig00025590
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00025590 (296 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAA87068.2 ethylene-responsive element binding protein1 homolog ... 110 5e-28 BAP93298.1 ethylene-responsive transcription factor homolog, par... 104 2e-27 BAP92184.1 ethylene-responsive transcription factor homolog, par... 104 2e-27 BAP92178.1 ethylene-responsive transcription factor homolog, par... 104 2e-27 BAP92157.1 ethylene-responsive transcription factor homolog, par... 104 2e-27 BAP92132.1 ethylene-responsive transcription factor homolog, par... 104 2e-27 XP_019190826.1 PREDICTED: ethylene-responsive transcription fact... 108 2e-27 XP_010055446.1 PREDICTED: ethylene-responsive transcription fact... 109 4e-27 XP_010518707.1 PREDICTED: ethylene-responsive transcription fact... 108 4e-27 XP_002271521.1 PREDICTED: ethylene-responsive transcription fact... 107 4e-27 KZV58560.1 ethylene-responsive transcription factor 1A-like [Dor... 107 5e-27 KVH91971.1 AP2/ERF domain-containing protein [Cynara cardunculus... 107 7e-27 XP_002271614.1 PREDICTED: ethylene-responsive transcription fact... 107 7e-27 CAN82632.1 hypothetical protein VITISV_028134 [Vitis vinifera] 106 1e-26 CAN81895.1 hypothetical protein VITISV_007029 [Vitis vinifera] 106 1e-26 XP_004152388.1 PREDICTED: ethylene-responsive transcription fact... 107 1e-26 XP_016553616.1 PREDICTED: ethylene-responsive transcription fact... 107 1e-26 XP_008437026.2 PREDICTED: ethylene-responsive transcription fact... 107 1e-26 XP_010441485.1 PREDICTED: ethylene-responsive transcription fact... 106 1e-26 XP_019190741.1 PREDICTED: ethylene-responsive transcription fact... 107 1e-26 >BAA87068.2 ethylene-responsive element binding protein1 homolog [Matricaria chamomilla] Length = 235 Score = 110 bits (275), Expect = 5e-28 Identities = 53/68 (77%), Positives = 55/68 (80%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 RRRPWGKYAAEIRDPAKNGARVWLGTY T A+ MRGSRALLNFPLRINSG Sbjct: 119 RRRPWGKYAAEIRDPAKNGARVWLGTYETAEDAAVAYDMAAYRMRGSRALLNFPLRINSG 178 Query: 114 EPEPVRVT 91 EPEPVR+T Sbjct: 179 EPEPVRIT 186 >BAP93298.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP93299.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP93300.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP93301.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP93302.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP93303.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP93304.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP93305.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93306.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93307.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93308.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93309.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93310.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93311.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93312.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93313.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93314.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93315.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93316.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93317.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93318.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93319.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93320.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93321.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93322.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93323.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93324.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93325.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93326.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93327.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93328.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93329.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93330.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93331.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93332.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93333.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93334.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93335.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93336.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93337.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP93338.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP93339.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP93340.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP93341.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP93342.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP93343.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP93344.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP93345.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93346.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93347.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93348.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93349.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93350.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93351.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93352.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93353.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93354.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93355.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93356.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93357.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93358.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93359.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93360.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93361.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93362.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93363.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93364.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93365.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93366.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93367.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93368.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93369.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93370.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93371.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93372.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93373.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] BAP93374.1 ethylene-responsive transcription factor homolog, partial [Rubus sp. MM-2014] Length = 86 Score = 104 bits (260), Expect = 2e-27 Identities = 49/68 (72%), Positives = 55/68 (80%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 R+RPWGK+AAEIRDPAKNGARVWLGT+ T A+ MRGSRALLNFPLR+NSG Sbjct: 17 RQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSG 76 Query: 114 EPEPVRVT 91 EP+PVRVT Sbjct: 77 EPDPVRVT 84 >BAP92184.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] Length = 89 Score = 104 bits (260), Expect = 2e-27 Identities = 50/68 (73%), Positives = 56/68 (82%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 R+RPWGK+AAEIRDPAKNGARVWLGT+ T A+ MRGSRALLNFPLR+NSG Sbjct: 20 RQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYXRAAYRMRGSRALLNFPLRVNSG 79 Query: 114 EPEPVRVT 91 EP+PVRVT Sbjct: 80 EPDPVRVT 87 >BAP92178.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] Length = 89 Score = 104 bits (260), Expect = 2e-27 Identities = 49/68 (72%), Positives = 55/68 (80%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 R+RPWGK+AAEIRDPAKNGARVWLGT+ T A+ MRGSRALLNFPLR+NSG Sbjct: 20 RQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSG 79 Query: 114 EPEPVRVT 91 EP+PVRVT Sbjct: 80 EPDPVRVT 87 >BAP92157.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92179.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] Length = 89 Score = 104 bits (260), Expect = 2e-27 Identities = 49/68 (72%), Positives = 55/68 (80%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 R+RPWGK+AAEIRDPAKNGARVWLGT+ T A+ MRGSRALLNFPLR+NSG Sbjct: 20 RQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSG 79 Query: 114 EPEPVRVT 91 EP+PVRVT Sbjct: 80 EPDPVRVT 87 >BAP92132.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92133.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92134.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92135.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92136.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92137.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92138.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92139.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92140.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92141.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92142.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92143.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92144.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92145.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92146.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92147.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92148.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92149.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92150.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92151.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92152.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92153.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92154.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92155.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92156.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92158.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92159.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92160.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92161.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92162.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92163.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92164.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92165.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92166.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92167.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92168.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92169.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92170.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92171.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92172.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92173.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92174.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92175.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92176.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92177.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92180.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92181.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92182.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92183.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92185.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92186.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92187.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92188.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92189.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92190.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92191.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92192.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92193.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92194.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92195.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92196.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92197.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92198.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92199.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92200.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92201.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92202.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92203.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92204.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92205.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92206.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92207.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92208.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92209.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92210.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92211.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92212.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92213.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92214.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92215.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92216.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92217.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92218.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92219.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92220.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92221.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92222.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92223.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92224.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92225.1 ethylene-responsive transcription factor homolog, partial [Rubus palmatus] BAP92226.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92227.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92228.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92229.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92230.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92231.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92232.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] BAP92233.1 ethylene-responsive transcription factor homolog, partial [Rubus grayanus] Length = 89 Score = 104 bits (260), Expect = 2e-27 Identities = 49/68 (72%), Positives = 55/68 (80%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 R+RPWGK+AAEIRDPAKNGARVWLGT+ T A+ MRGSRALLNFPLR+NSG Sbjct: 20 RQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSG 79 Query: 114 EPEPVRVT 91 EP+PVRVT Sbjct: 80 EPDPVRVT 87 >XP_019190826.1 PREDICTED: ethylene-responsive transcription factor 2-like [Ipomoea nil] Length = 239 Score = 108 bits (271), Expect = 2e-27 Identities = 52/68 (76%), Positives = 55/68 (80%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 RRRPWGK+AAEIRDPAKNGARVWLGTY T A+ MRGSRALLNFPLRINSG Sbjct: 130 RRRPWGKFAAEIRDPAKNGARVWLGTYETAEDAALAYDKAAYRMRGSRALLNFPLRINSG 189 Query: 114 EPEPVRVT 91 EPEPVR+T Sbjct: 190 EPEPVRIT 197 >XP_010055446.1 PREDICTED: ethylene-responsive transcription factor 2 [Eucalyptus grandis] Length = 279 Score = 109 bits (272), Expect = 4e-27 Identities = 53/68 (77%), Positives = 55/68 (80%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 RRRPWGK+AAEIRDPAKNGARVWLGTY T A+ MRGSRALLNFPLRINSG Sbjct: 139 RRRPWGKFAAEIRDPAKNGARVWLGTYETAEDAALAYDRAAYRMRGSRALLNFPLRINSG 198 Query: 114 EPEPVRVT 91 EPEPVRVT Sbjct: 199 EPEPVRVT 206 >XP_010518707.1 PREDICTED: ethylene-responsive transcription factor 1A [Tarenaya hassleriana] Length = 247 Score = 108 bits (270), Expect = 4e-27 Identities = 52/68 (76%), Positives = 55/68 (80%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 RRRPWGK+AAEIRDPAKNGARVWLGT+ T AF MRGSRALLNFPLR+NSG Sbjct: 134 RRRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSG 193 Query: 114 EPEPVRVT 91 EPEPVRVT Sbjct: 194 EPEPVRVT 201 >XP_002271521.1 PREDICTED: ethylene-responsive transcription factor 2 [Vitis vinifera] CBI16659.3 unnamed protein product, partial [Vitis vinifera] Length = 207 Score = 107 bits (267), Expect = 4e-27 Identities = 51/68 (75%), Positives = 54/68 (79%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 RRRPWGKYAAEIRDPAKNGARVWLGTY T AF +RGSRALLNFPLR+ SG Sbjct: 87 RRRPWGKYAAEIRDPAKNGARVWLGTYETAEDAALAYDRAAFRIRGSRALLNFPLRVGSG 146 Query: 114 EPEPVRVT 91 EPEPVR+T Sbjct: 147 EPEPVRIT 154 >KZV58560.1 ethylene-responsive transcription factor 1A-like [Dorcoceras hygrometricum] Length = 233 Score = 107 bits (268), Expect = 5e-27 Identities = 51/68 (75%), Positives = 55/68 (80%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 RRRPWGK+AAEIRDPAKNGARVWLGTY T AF MRG+RALLNFPLRINSG Sbjct: 126 RRRPWGKFAAEIRDPAKNGARVWLGTYETAEDAALAYDRAAFQMRGARALLNFPLRINSG 185 Query: 114 EPEPVRVT 91 EP+PVR+T Sbjct: 186 EPDPVRIT 193 >KVH91971.1 AP2/ERF domain-containing protein [Cynara cardunculus var. scolymus] Length = 228 Score = 107 bits (267), Expect = 7e-27 Identities = 51/68 (75%), Positives = 55/68 (80%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 RRRPWGK+AAEIRDPAKNGARVWLGT+ T A+ MRGSRALLNFPLRINSG Sbjct: 132 RRRPWGKFAAEIRDPAKNGARVWLGTFETAEDAAFAYDTAAYRMRGSRALLNFPLRINSG 191 Query: 114 EPEPVRVT 91 EPEPVR+T Sbjct: 192 EPEPVRIT 199 >XP_002271614.1 PREDICTED: ethylene-responsive transcription factor 2-like [Vitis vinifera] Length = 214 Score = 107 bits (266), Expect = 7e-27 Identities = 51/68 (75%), Positives = 54/68 (79%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 RRRPWGKYAAEIRDPAKNG+RVWLGTY T A+ MRGSRALLNFPLRI SG Sbjct: 96 RRRPWGKYAAEIRDPAKNGSRVWLGTYETAEDAALAYDQAAYRMRGSRALLNFPLRIGSG 155 Query: 114 EPEPVRVT 91 EPEPVR+T Sbjct: 156 EPEPVRIT 163 >CAN82632.1 hypothetical protein VITISV_028134 [Vitis vinifera] Length = 202 Score = 106 bits (264), Expect = 1e-26 Identities = 50/68 (73%), Positives = 54/68 (79%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 RRRPWGKYAAEIRDPAKNG+RVWLGTY T AF +RGSRALLNFPLR+ SG Sbjct: 87 RRRPWGKYAAEIRDPAKNGSRVWLGTYETAEDAALAYDRAAFRIRGSRALLNFPLRVGSG 146 Query: 114 EPEPVRVT 91 EPEPVR+T Sbjct: 147 EPEPVRIT 154 >CAN81895.1 hypothetical protein VITISV_007029 [Vitis vinifera] Length = 202 Score = 106 bits (264), Expect = 1e-26 Identities = 50/68 (73%), Positives = 54/68 (79%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 RRRPWGKYAAEIRDPAKNG+RVWLGTY T AF +RGSRALLNFPLR+ SG Sbjct: 87 RRRPWGKYAAEIRDPAKNGSRVWLGTYETAEDAALAYDRAAFRIRGSRALLNFPLRVGSG 146 Query: 114 EPEPVRVT 91 EPEPVR+T Sbjct: 147 EPEPVRIT 154 >XP_004152388.1 PREDICTED: ethylene-responsive transcription factor 1A-like [Cucumis sativus] KGN50290.1 AP2/ERF domain-containing transcription factor [Cucumis sativus] Length = 250 Score = 107 bits (267), Expect = 1e-26 Identities = 51/68 (75%), Positives = 55/68 (80%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 R+RPWGK+AAEIRDPAKNGARVWLGTY T A+ MRGSRALLNFPLR+NSG Sbjct: 136 RQRPWGKFAAEIRDPAKNGARVWLGTYETAEDAALAYDRAAYRMRGSRALLNFPLRVNSG 195 Query: 114 EPEPVRVT 91 EPEPVRVT Sbjct: 196 EPEPVRVT 203 >XP_016553616.1 PREDICTED: ethylene-responsive transcription factor 2-like [Capsicum annuum] Length = 235 Score = 107 bits (266), Expect = 1e-26 Identities = 52/67 (77%), Positives = 54/67 (80%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 R+RPWGK+AAEIRDPAKNGARVWLGTY T AF MRGSRALLNFPLRINSG Sbjct: 141 RQRPWGKFAAEIRDPAKNGARVWLGTYETAEDAALAYDKAAFRMRGSRALLNFPLRINSG 200 Query: 114 EPEPVRV 94 EPEPVRV Sbjct: 201 EPEPVRV 207 >XP_008437026.2 PREDICTED: ethylene-responsive transcription factor 1A-like [Cucumis melo] Length = 252 Score = 107 bits (267), Expect = 1e-26 Identities = 51/68 (75%), Positives = 55/68 (80%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 R+RPWGK+AAEIRDPAKNGARVWLGTY T A+ MRGSRALLNFPLR+NSG Sbjct: 138 RQRPWGKFAAEIRDPAKNGARVWLGTYETAEDAALAYDRAAYRMRGSRALLNFPLRVNSG 197 Query: 114 EPEPVRVT 91 EPEPVRVT Sbjct: 198 EPEPVRVT 205 >XP_010441485.1 PREDICTED: ethylene-responsive transcription factor 2-like [Camelina sativa] Length = 226 Score = 106 bits (265), Expect = 1e-26 Identities = 50/68 (73%), Positives = 55/68 (80%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 R+RPWGK+AAEIRDPAKNGARVWLGT+ T AF MRGSRALLNFPLR+NSG Sbjct: 118 RQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSG 177 Query: 114 EPEPVRVT 91 EPEPVR+T Sbjct: 178 EPEPVRIT 185 >XP_019190741.1 PREDICTED: ethylene-responsive transcription factor 2-like [Ipomoea nil] Length = 279 Score = 107 bits (268), Expect = 1e-26 Identities = 51/68 (75%), Positives = 55/68 (80%) Frame = -3 Query: 294 RRRPWGKYAAEIRDPAKNGARVWLGTYHTXXXXXXXXXXXAFHMRGSRALLNFPLRINSG 115 RRRPWGK+AAEIRDPAKNGARVWLGTY T AF +RG+RALLNFPLRINSG Sbjct: 159 RRRPWGKFAAEIRDPAKNGARVWLGTYETAEDAAVAYDRAAFRLRGARALLNFPLRINSG 218 Query: 114 EPEPVRVT 91 EPEPVR+T Sbjct: 219 EPEPVRIT 226