BLASTX nr result
ID: Lithospermum23_contig00025188
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00025188 (362 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019465365.1 PREDICTED: uncharacterized protein LOC109363559 [... 52 8e-06 XP_007143341.1 hypothetical protein PHAVU_007G064300g [Phaseolus... 53 1e-05 >XP_019465365.1 PREDICTED: uncharacterized protein LOC109363559 [Lupinus angustifolius] Length = 185 Score = 52.4 bits (124), Expect = 8e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 155 EYKLNKIEHRDIERQRRKEMATLQASLRSLIPL 253 E+ + KI HRDIERQRR+EMATL ASLRSL+PL Sbjct: 68 EHYMKKIVHRDIERQRRQEMATLHASLRSLLPL 100 >XP_007143341.1 hypothetical protein PHAVU_007G064300g [Phaseolus vulgaris] ESW15335.1 hypothetical protein PHAVU_007G064300g [Phaseolus vulgaris] Length = 245 Score = 52.8 bits (125), Expect = 1e-05 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +2 Query: 137 HSHMTMEYKLNKIEHRDIERQRRKEMATLQASLRSLIPLS 256 H + T E K+ HR+IER+RR+EMATL ASLRSL+PLS Sbjct: 64 HENSTQEESAKKMVHREIERKRRQEMATLHASLRSLLPLS 103