BLASTX nr result
ID: Lithospermum23_contig00024981
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00024981 (537 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009764348.1 PREDICTED: cyclin-dependent protein kinase inhibi... 95 3e-22 OIT33796.1 hypothetical protein A4A49_15681 [Nicotiana attenuata] 90 2e-20 XP_016501850.1 PREDICTED: cyclin-dependent protein kinase inhibi... 89 6e-20 OIT34018.1 hypothetical protein A4A49_28671 [Nicotiana attenuata] 92 7e-20 XP_009628058.2 PREDICTED: cyclin-dependent protein kinase inhibi... 89 8e-20 XP_009624219.1 PREDICTED: cyclin-dependent protein kinase inhibi... 91 9e-20 XP_006379504.1 hypothetical protein POPTR_0008s02960g [Populus t... 89 1e-19 OIT39789.1 hypothetical protein A4A49_58257, partial [Nicotiana ... 86 1e-18 XP_009800490.1 PREDICTED: cyclin-dependent protein kinase inhibi... 85 3e-18 OAY45809.1 hypothetical protein MANES_07G093500 [Manihot esculenta] 84 6e-18 XP_002316411.2 hypothetical protein POPTR_0010s23800g [Populus t... 84 6e-18 XP_012090347.1 PREDICTED: cyclin-dependent protein kinase inhibi... 84 9e-18 CDO99827.1 unnamed protein product [Coffea canephora] 84 2e-17 XP_015067983.1 PREDICTED: cyclin-dependent protein kinase inhibi... 83 2e-17 XP_016565343.1 PREDICTED: uncharacterized protein LOC107863745 [... 83 3e-17 XP_006364442.1 PREDICTED: cyclin-dependent protein kinase inhibi... 82 5e-17 KVI05065.1 hypothetical protein Ccrd_016620 [Cynara cardunculus ... 80 4e-16 KVI06853.1 hypothetical protein Ccrd_014791 [Cynara cardunculus ... 79 6e-16 XP_012834511.1 PREDICTED: cyclin-dependent protein kinase inhibi... 77 5e-15 XP_011101559.1 PREDICTED: cyclin-dependent protein kinase inhibi... 76 1e-14 >XP_009764348.1 PREDICTED: cyclin-dependent protein kinase inhibitor SMR1 [Nicotiana sylvestris] Length = 107 Score = 95.1 bits (235), Expect = 3e-22 Identities = 55/119 (46%), Positives = 76/119 (63%), Gaps = 1/119 (0%) Frame = -1 Query: 492 MSTNLQHQQDLPQTRLVQTIKIESLQNSYVSEDVFSPTRPLDRSGSRNNEEEDECKTPRS 313 MST+L+ QDL + +Q KI+ S + D+ + +++ED+C+TP+S Sbjct: 1 MSTDLELSQDLLE---IQLPKIKVTNCSSQNSDIVT------------SDDEDKCQTPKS 45 Query: 312 TKNLIPKINSCPPAPKKSKRVPSCKRK-LEFFEVTARQEIESFFKRAGVINSNETAKRR 139 + LIPKI SCPPAPKK KRV SCKRK L+FFE+ R EI+SFFK V ++ +T KRR Sbjct: 46 PQFLIPKILSCPPAPKKPKRVSSCKRKLLDFFEIVKRDEIDSFFKLVDVNSNGDTKKRR 104 >OIT33796.1 hypothetical protein A4A49_15681 [Nicotiana attenuata] Length = 101 Score = 90.1 bits (222), Expect = 2e-20 Identities = 55/110 (50%), Positives = 71/110 (64%), Gaps = 6/110 (5%) Frame = -1 Query: 492 MSTNLQHQQD--LPQTRLVQTIKIESLQNSYVSEDVFSPTRPLDRSGSRNNEEEDECKTP 319 MST+L+ + + LP+ +++ T+ S QNS SE EEEDE KTP Sbjct: 1 MSTDLEFRLEIQLPKIKVITTL---SSQNSRDSE-----------------EEEDEIKTP 40 Query: 318 RSTKNLIPKINSCPPAPKKSKRVPSCKRK----LEFFEVTARQEIESFFK 181 +S +NLIPKI SCPPAPKK KRV SCKRK L+FFEV AR+E++SFF+ Sbjct: 41 KSPQNLIPKILSCPPAPKKPKRVISCKRKLVDELQFFEVAAREEVDSFFR 90 >XP_016501850.1 PREDICTED: cyclin-dependent protein kinase inhibitor SMR2-like [Nicotiana tabacum] Length = 107 Score = 89.4 bits (220), Expect = 6e-20 Identities = 52/108 (48%), Positives = 68/108 (62%), Gaps = 4/108 (3%) Frame = -1 Query: 492 MSTNLQHQQDLPQTRLVQTIKIESLQNSYVSEDVFSPTRPLDRSGSRNNEEEDECKTPRS 313 MST+L+ + ++ ++ S QNS D SR++EEE+E KTPRS Sbjct: 1 MSTDLEFRLEIQLPKINVITATLSSQNSD------------DGKNSRDSEEEEEIKTPRS 48 Query: 312 TKNLIPKINSCPPAPKKSKRVPSCKRK----LEFFEVTARQEIESFFK 181 + LIPKI SCPPAPKK KRV SCKRK L+FFEV AR+E++SFF+ Sbjct: 49 PQYLIPKILSCPPAPKKPKRVISCKRKLVDELQFFEVAAREEVDSFFR 96 >OIT34018.1 hypothetical protein A4A49_28671 [Nicotiana attenuata] Length = 196 Score = 91.7 bits (226), Expect = 7e-20 Identities = 54/121 (44%), Positives = 72/121 (59%), Gaps = 5/121 (4%) Frame = -1 Query: 492 MSTNLQHQQDLPQTRLVQTIKIESLQNSYVSEDVFSPTRPLDRSGSRNNEEEDECKTPRS 313 MST+L+ QQD +++L IKI + QNS +E+ S T EDEC TP+S Sbjct: 1 MSTDLEFQQDFLESQL-PNIKITTSQNSSNTEERCSSTI----------SNEDECHTPKS 49 Query: 312 TKNLIPKINSCPPAPKKSKRVPSCKRK-----LEFFEVTARQEIESFFKRAGVINSNETA 148 + L+PKI CP APKK KR+PSCKRK L+FFE+ AR E++SFF+ N+ Sbjct: 50 PQFLLPKILDCPTAPKKPKRIPSCKRKLLDHELQFFEIVARDEVDSFFRTVEGQRRNQNL 109 Query: 147 K 145 K Sbjct: 110 K 110 Score = 54.3 bits (129), Expect = 7e-06 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = -1 Query: 372 LDRSGSRNNEEEDECKTPRSTKNLIPKINSCPPAPKKSKRVPSCKRKL 229 L++ S + EE++C TP S K IPK SCPPAPKK K+V KRKL Sbjct: 123 LEKCSSSSTSEENKCLTPTSPKFFIPKNLSCPPAPKKPKKVALSKRKL 170 >XP_009628058.2 PREDICTED: cyclin-dependent protein kinase inhibitor SMR2-like, partial [Nicotiana tomentosiformis] Length = 95 Score = 88.6 bits (218), Expect = 8e-20 Identities = 52/107 (48%), Positives = 67/107 (62%), Gaps = 4/107 (3%) Frame = -1 Query: 492 MSTNLQHQQDLPQTRLVQTIKIESLQNSYVSEDVFSPTRPLDRSGSRNNEEEDECKTPRS 313 MST+L+ + ++ ++ S QNS D SR++EEE+E KTPRS Sbjct: 1 MSTDLEFRLEIQLPKINVITATLSSQNSD------------DGKNSRDSEEEEEIKTPRS 48 Query: 312 TKNLIPKINSCPPAPKKSKRVPSCKRK----LEFFEVTARQEIESFF 184 + LIPKI SCPPAPKK KRV SCKRK L+FFEV AR+E++SFF Sbjct: 49 PQYLIPKILSCPPAPKKPKRVISCKRKLVDELQFFEVAAREEVDSFF 95 >XP_009624219.1 PREDICTED: cyclin-dependent protein kinase inhibitor SIM-like [Nicotiana tomentosiformis] Length = 195 Score = 91.3 bits (225), Expect = 9e-20 Identities = 53/121 (43%), Positives = 71/121 (58%), Gaps = 5/121 (4%) Frame = -1 Query: 492 MSTNLQHQQDLPQTRLVQTIKIESLQNSYVSEDVFSPTRPLDRSGSRNNEEEDECKTPRS 313 MST+L+ QQD + L +KI S QNS +++ S T EDEC TP+S Sbjct: 1 MSTDLEFQQDFLENHL-PNVKITSSQNSNNTDERCSSTI----------SNEDECHTPKS 49 Query: 312 TKNLIPKINSCPPAPKKSKRVPSCKRK-----LEFFEVTARQEIESFFKRAGVINSNETA 148 + L+PKI +CP APKK KR+PSCKRK L+FFE+ AR E++SFF+ N+ Sbjct: 50 PQFLLPKILNCPTAPKKPKRIPSCKRKLLDHELQFFEIVARDEVDSFFRTVDGQRRNQNL 109 Query: 147 K 145 K Sbjct: 110 K 110 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/63 (44%), Positives = 36/63 (57%) Frame = -1 Query: 417 QNSYVSEDVFSPTRPLDRSGSRNNEEEDECKTPRSTKNLIPKINSCPPAPKKSKRVPSCK 238 QN + + ++R + EE++C TP S K IPKI SCPPAPKK K+V K Sbjct: 107 QNLKFMDSQTTAAASVERCSGSSTSEENKCLTPTSPKFFIPKILSCPPAPKKPKKVALSK 166 Query: 237 RKL 229 RKL Sbjct: 167 RKL 169 >XP_006379504.1 hypothetical protein POPTR_0008s02960g [Populus trichocarpa] ERP57301.1 hypothetical protein POPTR_0008s02960g [Populus trichocarpa] Length = 113 Score = 88.6 bits (218), Expect = 1e-19 Identities = 46/107 (42%), Positives = 73/107 (68%), Gaps = 3/107 (2%) Frame = -1 Query: 492 MSTNLQHQQDLPQTRLVQTIKIESLQNSYVSEDVFSPTRPLDRSGSRNNEEEDECKTPRS 313 MST+L+ +QDLP+ + V+ +K E+LQ+ ++D + + + N E D+C+TP+S Sbjct: 1 MSTDLESRQDLPRIQ-VRAVKTETLQSCSATDDKETIIK-------QENSETDDCQTPKS 52 Query: 312 TKNLIPKINSCPPAPKKSKRVPSCKRK---LEFFEVTARQEIESFFK 181 ++ IP + SCPPAP+K +R SCKRK LEFFE+ R+E++SFF+ Sbjct: 53 EEHKIPAVLSCPPAPRKPRRSFSCKRKLTELEFFEIVNREEVDSFFQ 99 >OIT39789.1 hypothetical protein A4A49_58257, partial [Nicotiana attenuata] Length = 88 Score = 85.5 bits (210), Expect = 1e-18 Identities = 42/65 (64%), Positives = 51/65 (78%), Gaps = 4/65 (6%) Frame = -1 Query: 363 SGSRNNEEEDECKTPRSTKNLIPKINSCPPAPKKSKRVPSCKRK----LEFFEVTARQEI 196 S + EEE+E KTP+S +NLIPKI SCPPAPKK KR+ SCKRK L+FFEV AR+E+ Sbjct: 13 SSQNSIEEEEEIKTPKSPQNLIPKILSCPPAPKKPKRLISCKRKLVDELQFFEVAAREEV 72 Query: 195 ESFFK 181 +SFFK Sbjct: 73 DSFFK 77 >XP_009800490.1 PREDICTED: cyclin-dependent protein kinase inhibitor SMR2-like [Nicotiana sylvestris] Length = 97 Score = 84.7 bits (208), Expect = 3e-18 Identities = 41/63 (65%), Positives = 51/63 (80%), Gaps = 4/63 (6%) Frame = -1 Query: 357 SRNNEEEDECKTPRSTKNLIPKINSCPPAPKKSKRVPSCKRK----LEFFEVTARQEIES 190 S+N+ E+E KTP+S +NLIPKI SCPPAPKK KRV SCKRK L+FFEV AR+E++S Sbjct: 24 SQNSRGEEEIKTPKSPQNLIPKILSCPPAPKKPKRVISCKRKLVDELQFFEVAAREEVDS 83 Query: 189 FFK 181 FF+ Sbjct: 84 FFR 86 >OAY45809.1 hypothetical protein MANES_07G093500 [Manihot esculenta] Length = 114 Score = 84.3 bits (207), Expect = 6e-18 Identities = 54/122 (44%), Positives = 76/122 (62%), Gaps = 4/122 (3%) Frame = -1 Query: 492 MSTNLQHQQDLPQTRLVQTIKIESLQNSYVSEDVFSPTRPLDRSGSRNNEEEDECKTPRS 313 MST+LQ +QDLP+ + V IKI++L + + + D+ E DEC+TP S Sbjct: 1 MSTDLQLRQDLPRIQ-VPPIKIQTLGSCSATME--------DQKDVIQQENSDECRTPTS 51 Query: 312 TKNLIPKINSCPPAPKK-SKRVPSCKRKL---EFFEVTARQEIESFFKRAGVINSNETAK 145 ++ IP I SCPPAP+K +R+ SCKRKL EFFE+ RQE+ESFF+ + E+AK Sbjct: 52 QEHKIPTILSCPPAPQKPRRRMFSCKRKLSEFEFFEIVNRQEVESFFRSS--FQLVESAK 109 Query: 144 RR 139 +R Sbjct: 110 KR 111 >XP_002316411.2 hypothetical protein POPTR_0010s23800g [Populus trichocarpa] EEF02582.2 hypothetical protein POPTR_0010s23800g [Populus trichocarpa] Length = 116 Score = 84.3 bits (207), Expect = 6e-18 Identities = 44/107 (41%), Positives = 71/107 (66%), Gaps = 3/107 (2%) Frame = -1 Query: 492 MSTNLQHQQDLPQTRLVQTIKIESLQNSYVSEDVFSPTRPLDRSGSRNNEEEDECKTPRS 313 MST+L+ DLP+ ++ IKIE+LQ+ ++ + + N+E +D+C+TP+S Sbjct: 1 MSTDLELLHDLPRIQVRPAIKIETLQSCSATDGNKAIIQ------QENSETDDDCQTPKS 54 Query: 312 TKNLIPKINSCPPAPKKSKRVPSCKRKL---EFFEVTARQEIESFFK 181 ++ IP + SCPPAP+K+KR SCKRKL +FFE+ +E++SFF+ Sbjct: 55 EEHKIPAVLSCPPAPRKAKRNISCKRKLTEIDFFEIVNGEEVDSFFQ 101 >XP_012090347.1 PREDICTED: cyclin-dependent protein kinase inhibitor SMR1 [Jatropha curcas] KDP45062.1 hypothetical protein JCGZ_01562 [Jatropha curcas] Length = 117 Score = 84.0 bits (206), Expect = 9e-18 Identities = 44/107 (41%), Positives = 72/107 (67%), Gaps = 3/107 (2%) Frame = -1 Query: 492 MSTNLQHQQDLPQTRLVQTIKIESLQNSYVSEDVFSPTRPLDRSGSRNNEEEDECKTPRS 313 MS +L+ +Q P+ ++ T K+E+LQ+ S+DV +G+R+++ +D C+TP S Sbjct: 1 MSADLELRQGSPRIQVPST-KVETLQSCSGSDDV----EIRRENGNRDSDCDDGCRTPTS 55 Query: 312 TKNLIPKINSCPPAPKKSKRVPSCKRKL---EFFEVTARQEIESFFK 181 ++ IP + SCPPAP+K +R+PSCKRKL +FF++ QE+ES F+ Sbjct: 56 EEHKIPAVLSCPPAPRKPRRMPSCKRKLSEFDFFQIVKSQEVESLFR 102 >CDO99827.1 unnamed protein product [Coffea canephora] Length = 126 Score = 83.6 bits (205), Expect = 2e-17 Identities = 56/125 (44%), Positives = 77/125 (61%), Gaps = 6/125 (4%) Frame = -1 Query: 492 MSTNLQHQQDLPQTRLVQTIKIESLQNSYVSED---VFSPTRPLDRSGSRNNEEEDECKT 322 MST+L+ +Q+L + RL + I+ Q+S ++D V +GS EEE EC T Sbjct: 1 MSTDLELRQELVEIRL-PALNIKVSQSSDSTDDGGAVIQSQESTTGTGSCIIEEE-ECHT 58 Query: 321 PRSTKNLIPKINSCPPAPKKSKR--VPSCKRKL-EFFEVTARQEIESFFKRAGVINSNET 151 P+S +++IP+I SCPPAPKK R SCKRKL EFFE R+EIESFF++ V NS Sbjct: 59 PKSPQHMIPEILSCPPAPKKPTRPASSSCKRKLSEFFEFVGREEIESFFRQLDVPNSTTG 118 Query: 150 AKRRR 136 ++R Sbjct: 119 VIKKR 123 >XP_015067983.1 PREDICTED: cyclin-dependent protein kinase inhibitor SMR1 [Solanum pennellii] Length = 115 Score = 83.2 bits (204), Expect = 2e-17 Identities = 53/123 (43%), Positives = 72/123 (58%), Gaps = 4/123 (3%) Frame = -1 Query: 492 MSTNLQHQQDLPQTRLVQTIKIESLQNSYVSEDVFSPTRPLDRSGSRNNEEEDECKTPRS 313 MS +LQ ++ L + +L I QN +S+D L+R N E+ E +TP S Sbjct: 1 MSRDLQSRRPLSEIQLPNIIS----QNENISKD-----HDLERC---NKEQAVEIRTPGS 48 Query: 312 TKNLIPKINSCPPAPKKSKRVPSCKRK----LEFFEVTARQEIESFFKRAGVINSNETAK 145 +NLIPKI SCPPAPKK KR SCKRK LEF++VTAR+E++SFF + + Sbjct: 49 PQNLIPKILSCPPAPKKPKRGISCKRKLLSDLEFYDVTAREEVDSFFSSVDENSKSCAGN 108 Query: 144 RRR 136 R+R Sbjct: 109 RKR 111 >XP_016565343.1 PREDICTED: uncharacterized protein LOC107863745 [Capsicum annuum] Length = 119 Score = 82.8 bits (203), Expect = 3e-17 Identities = 49/118 (41%), Positives = 69/118 (58%), Gaps = 8/118 (6%) Frame = -1 Query: 468 QDLPQTRLVQTIKIESLQNSYVSEDVFSPTRPLDRSGSRNNEEEDECKTPRSTKNLIPKI 289 +DL R + I++ ++ NS S ++ + N E+ E +TP + +NLIPKI Sbjct: 3 RDLQSRRPLSEIQLPNIINSSSSSNILRD----EPERCSNKEQAAEIRTPGTPQNLIPKI 58 Query: 288 NSCPPAPKKSKRVPSCKRK----LEFFEVTARQEIESFFK----RAGVINSNETAKRR 139 SCPPAPKK KRV SCKRK LEFF+V A++E++SFFK + +N KRR Sbjct: 59 LSCPPAPKKPKRVISCKRKLLGELEFFDVAAKEEVDSFFKSVDENSKPCGANSNKKRR 116 >XP_006364442.1 PREDICTED: cyclin-dependent protein kinase inhibitor SMR1 [Solanum tuberosum] Length = 119 Score = 82.0 bits (201), Expect = 5e-17 Identities = 53/124 (42%), Positives = 73/124 (58%), Gaps = 5/124 (4%) Frame = -1 Query: 492 MSTNLQHQQDLPQTRLVQTIKIESLQNSYVSEDVFSPTRPLDRSGSRNNEEED-ECKTPR 316 MS +LQ ++ L + +L I QN +S+D L+R S N+E+ E +TP Sbjct: 1 MSRDLQSRRPLSEIQLPSIIS----QNENISKD-----HDLERCISTTNKEQAVEIRTPG 51 Query: 315 STKNLIPKINSCPPAPKKSKRVPSCKRK----LEFFEVTARQEIESFFKRAGVINSNETA 148 S +NLIPKI SCPPAPKK KR SCKRK LEF++V AR+E++SFF + + Sbjct: 52 SPQNLIPKILSCPPAPKKPKRGISCKRKLLSDLEFYDVAAREEVDSFFSSVDENSKSCGG 111 Query: 147 KRRR 136 R+R Sbjct: 112 NRKR 115 >KVI05065.1 hypothetical protein Ccrd_016620 [Cynara cardunculus var. scolymus] Length = 117 Score = 79.7 bits (195), Expect = 4e-16 Identities = 52/125 (41%), Positives = 73/125 (58%), Gaps = 6/125 (4%) Frame = -1 Query: 492 MSTNLQHQ-QDLPQTRLVQ-TIKIESLQNSYVSEDVFSPTRPLDRSGSRNNEEEDECKTP 319 MS +LQ + QDLP +L T+K+ Q E S +E+ +EC TP Sbjct: 1 MSADLQFRLQDLPAIQLSSLTLKLPPPQQESSEE-----------SCRTQSEQVEECVTP 49 Query: 318 RSTKNLIPKINSCPPAPKKSKR-VPSCKRKL---EFFEVTARQEIESFFKRAGVINSNET 151 S ++ IP+I SCPP PKK + PSCKR+L +FFEV AR+EI+SFFK + + E+ Sbjct: 50 TSPEHRIPEILSCPPPPKKQRHSAPSCKRRLCEFQFFEVVAREEIDSFFKSSYEFINQES 109 Query: 150 AKRRR 136 +K+RR Sbjct: 110 SKKRR 114 >KVI06853.1 hypothetical protein Ccrd_014791 [Cynara cardunculus var. scolymus] Length = 123 Score = 79.3 bits (194), Expect = 6e-16 Identities = 51/125 (40%), Positives = 72/125 (57%), Gaps = 6/125 (4%) Frame = -1 Query: 492 MSTNLQHQQDLPQTRLVQT-IKIESLQNSYVSEDVFSPTRPLDRSGSRNNEEEDECKTPR 316 MST+LQ +QDLP RL IK+ S S T L+ ++ +EC+TP Sbjct: 1 MSTDLQLRQDLPAIRLTSLKIKLPESLPQLDSTSEESCTIQLEE------QQLEECRTPT 54 Query: 315 STKNLIPKINSCPPAPKKSK-RVPSCKRKL---EFFEVTARQEIESFFKRA-GVINSNET 151 S ++ IP+I +CPP PKK + PSCKR++ +FFE+ AR E+ESFF+ + IN N Sbjct: 55 SPEHRIPQIITCPPPPKKQRISGPSCKRRISEFQFFEIVARDEVESFFRSSYEFINQNSN 114 Query: 150 AKRRR 136 +RR Sbjct: 115 TNKRR 119 >XP_012834511.1 PREDICTED: cyclin-dependent protein kinase inhibitor SMR1-like [Erythranthe guttata] Length = 106 Score = 76.6 bits (187), Expect = 5e-15 Identities = 50/121 (41%), Positives = 67/121 (55%), Gaps = 4/121 (3%) Frame = -1 Query: 492 MSTNLQHQQDLPQTRLVQTIKIESL-QNSYVSEDVFSPTRPLDRSGSRNNEEEDECKTPR 316 MST+L+ + LP IKI S Q S ++ D + +EE+ C TPR Sbjct: 1 MSTDLELFRQLP------IIKINSTPQKSDITTD-------------KEEKEEENCHTPR 41 Query: 315 STKNLIPKINSCPPAPKKSKRVPSCKRK---LEFFEVTARQEIESFFKRAGVINSNETAK 145 S K++IP SCPPAPKK + +CKRK L+FFE R+EIES F+ A V +N + K Sbjct: 42 SPKHMIPTAVSCPPAPKKRRPAAACKRKLCELQFFEFVGREEIESLFEIAQVNFNNRSTK 101 Query: 144 R 142 R Sbjct: 102 R 102 >XP_011101559.1 PREDICTED: cyclin-dependent protein kinase inhibitor SMR1 [Sesamum indicum] Length = 110 Score = 75.9 bits (185), Expect = 1e-14 Identities = 43/84 (51%), Positives = 52/84 (61%), Gaps = 7/84 (8%) Frame = -1 Query: 369 DRSGSRNNEEEDECKTPRSTKNLIPKINSCPPAPKK---SKRVPSCKRKL---EFFEVTA 208 D G + ED+C TPRS ++IP I SCPPAP+K + SCKR+L +FFE A Sbjct: 24 DHDGDQGCVAEDDCHTPRSPHHMIPPILSCPPAPRKPPPRRTGASCKRRLWEFDFFETVA 83 Query: 207 RQEIESFFKRAGV-INSNETAKRR 139 R+EIESFFKR IN AKRR Sbjct: 84 REEIESFFKRVEEGINGGAAAKRR 107