BLASTX nr result
ID: Lithospermum23_contig00024587
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00024587 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006414230.1 hypothetical protein EUTSA_v10025432mg [Eutrema s... 54 3e-06 EYU19295.1 hypothetical protein MIMGU_mgv1a005826mg [Erythranthe... 53 8e-06 KMZ65609.1 Myb transcription factor [Zostera marina] 52 1e-05 >XP_006414230.1 hypothetical protein EUTSA_v10025432mg [Eutrema salsugineum] ESQ55683.1 hypothetical protein EUTSA_v10025432mg [Eutrema salsugineum] Length = 386 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/44 (54%), Positives = 31/44 (70%) Frame = +3 Query: 153 KSPNYYKPNSIKNIINPTNSKSSMTRRCSHCSNNGHNSRTCPHK 284 + PN +P+ I+ T S S MTRRCSHC+ NGHNSRTCP++ Sbjct: 22 EDPNRARPDPIRI----TKSLSDMTRRCSHCNQNGHNSRTCPNR 61 >EYU19295.1 hypothetical protein MIMGU_mgv1a005826mg [Erythranthe guttata] Length = 469 Score = 52.8 bits (125), Expect = 8e-06 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 8/37 (21%) Frame = +3 Query: 198 NPTN--------SKSSMTRRCSHCSNNGHNSRTCPHK 284 NPTN +MTRRCSHCSNNGHNSRTCP++ Sbjct: 110 NPTNLGVLNFQFESGAMTRRCSHCSNNGHNSRTCPNR 146 >KMZ65609.1 Myb transcription factor [Zostera marina] Length = 362 Score = 52.4 bits (124), Expect = 1e-05 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +3 Query: 222 MTRRCSHCSNNGHNSRTCPHKT 287 MTRRCSHCSNNGHNSRTCP KT Sbjct: 1 MTRRCSHCSNNGHNSRTCPTKT 22