BLASTX nr result
ID: Lithospermum23_contig00024418
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00024418 (394 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019167381.1 PREDICTED: stromal processing peptidase, chloropl... 60 6e-08 >XP_019167381.1 PREDICTED: stromal processing peptidase, chloroplastic [Ipomoea nil] XP_019167382.1 PREDICTED: stromal processing peptidase, chloroplastic [Ipomoea nil] Length = 1269 Score = 60.1 bits (144), Expect = 6e-08 Identities = 43/119 (36%), Positives = 60/119 (50%), Gaps = 10/119 (8%) Frame = +2 Query: 68 MQASLVLYTNTKPLLG---VKPLHTTENSPSSTCC-----LSTNHDWVLHGFKKSINLSH 223 MQAS V++ NTKP+L VK LH+ + PS CC LS +W ++ + Sbjct: 1 MQASSVIF-NTKPVLAPVQVKSLHSDPSLPS--CCSSSRLLSPPPNWTQLRRSVALRSNR 57 Query: 224 QYRSRTYLISQKNV--RHTPQLERLSTVSSFPNRCQSLSCFGYQQRKRVGFSTFRSGAF 394 R YL+ KN R+ Q E LS ++ NRC +SCF + QRK G + + AF Sbjct: 58 HLHHRAYLLKNKNSVRRYLSQSEELSPQANSQNRCPHVSCFRHLQRKHTGINRLATRAF 116