BLASTX nr result
ID: Lithospermum23_contig00024290
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00024290 (669 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018459215.1 PREDICTED: deSI-like protein At4g17486 isoform X2... 57 3e-06 XP_018459213.1 PREDICTED: deSI-like protein At4g17486 isoform X1... 57 3e-06 GAU27024.1 hypothetical protein TSUD_313860 [Trifolium subterran... 54 4e-06 KVH90256.1 hypothetical protein Ccrd_007749 [Cynara cardunculus ... 56 4e-06 XP_002515452.1 PREDICTED: deSI-like protein At4g17486 [Ricinus c... 56 6e-06 XP_013700207.1 PREDICTED: deSI-like protein At4g17486 [Brassica ... 55 7e-06 GAV59970.1 DUF862 domain-containing protein [Cephalotus follicul... 55 8e-06 >XP_018459215.1 PREDICTED: deSI-like protein At4g17486 isoform X2 [Raphanus sativus] Length = 223 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = +2 Query: 548 MFCRMIESATGGIGKRNKKDGTVPVYLNVYDLTPINGYAY 667 M CRM+ TGG R KK G+VPVYLNVYDLTPINGYAY Sbjct: 1 MLCRMVV-VTGG---RKKKAGSVPVYLNVYDLTPINGYAY 36 >XP_018459213.1 PREDICTED: deSI-like protein At4g17486 isoform X1 [Raphanus sativus] Length = 229 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = +2 Query: 548 MFCRMIESATGGIGKRNKKDGTVPVYLNVYDLTPINGYAY 667 M CRM+ TGG R KK G+VPVYLNVYDLTPINGYAY Sbjct: 1 MLCRMVV-VTGG---RKKKAGSVPVYLNVYDLTPINGYAY 36 >GAU27024.1 hypothetical protein TSUD_313860 [Trifolium subterraneum] Length = 112 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +2 Query: 587 GKRNKKDGTVPVYLNVYDLTPINGYAY 667 G R KK GTVPVYLNVYDLTPINGYAY Sbjct: 8 GPRKKKPGTVPVYLNVYDLTPINGYAY 34 >KVH90256.1 hypothetical protein Ccrd_007749 [Cynara cardunculus var. scolymus] Length = 214 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/41 (68%), Positives = 29/41 (70%) Frame = +2 Query: 545 RMFCRMIESATGGIGKRNKKDGTVPVYLNVYDLTPINGYAY 667 +M CRMI R KK GTVPVYLNVYDLTPINGYAY Sbjct: 2 KMLCRMIP--------RKKKTGTVPVYLNVYDLTPINGYAY 34 >XP_002515452.1 PREDICTED: deSI-like protein At4g17486 [Ricinus communis] EEF46901.1 conserved hypothetical protein [Ricinus communis] Length = 230 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +2 Query: 548 MFCRMIESATGGIGKRNKKDGTVPVYLNVYDLTPINGYAY 667 M CRM+ + +R KK GTVPVYLNVYDLTPINGYAY Sbjct: 1 MLCRMV------LLQRKKKTGTVPVYLNVYDLTPINGYAY 34 >XP_013700207.1 PREDICTED: deSI-like protein At4g17486 [Brassica napus] Length = 216 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = +2 Query: 548 MFCRMIESATGGIGKRNKKDGTVPVYLNVYDLTPINGYAY 667 M CRM+ + R KK G+VPVYLNVYDLTPINGYAY Sbjct: 1 MLCRMVV-----VNSRKKKPGSVPVYLNVYDLTPINGYAY 35 >GAV59970.1 DUF862 domain-containing protein [Cephalotus follicularis] Length = 228 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = +2 Query: 548 MFCRMIESATGGIGKRNKKDGTVPVYLNVYDLTPINGYAY 667 M CRM+ G R KK G+VPVYLNVYDLTP NGYAY Sbjct: 1 MLCRMVS------GTRKKKSGSVPVYLNVYDLTPFNGYAY 34