BLASTX nr result
ID: Lithospermum23_contig00023901
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00023901 (289 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019189077.1 PREDICTED: pentatricopeptide repeat-containing pr... 94 2e-20 XP_010109227.1 hypothetical protein L484_011849 [Morus notabilis... 92 1e-19 XP_016564327.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 4e-19 XP_006350509.2 PREDICTED: pentatricopeptide repeat-containing pr... 90 7e-19 XP_016461618.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 7e-19 XP_009608026.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 7e-19 XP_016737289.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 2e-18 XP_016437029.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 2e-18 XP_010318041.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 2e-18 XP_009785818.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 2e-18 XP_015070487.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 2e-18 XP_019243938.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 3e-18 OMO87916.1 hypothetical protein CCACVL1_08679 [Corchorus capsula... 87 4e-18 XP_012843139.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 6e-18 XP_006491968.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 8e-18 XP_016716420.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 1e-17 XP_010267513.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 2e-17 XP_017609027.1 PREDICTED: pentatricopeptide repeat-containing pr... 85 3e-17 XP_012439962.1 PREDICTED: pentatricopeptide repeat-containing pr... 85 4e-17 XP_007039119.2 PREDICTED: pentatricopeptide repeat-containing pr... 84 5e-17 >XP_019189077.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Ipomoea nil] XP_019189079.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Ipomoea nil] Length = 857 Score = 94.0 bits (232), Expect = 2e-20 Identities = 40/66 (60%), Positives = 51/66 (77%) Frame = -1 Query: 217 EPISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQLF 38 +P++S+ YAS++ +CDSP +Q+HA +KNGF GHEFVETKLLQ Y KC C DA LF Sbjct: 65 DPLNSSAYASVLASCDSPELGKQVHAQALKNGFHGHEFVETKLLQMYGKCECLYDAVMLF 124 Query: 37 DKMPKR 20 DKMP+R Sbjct: 125 DKMPRR 130 >XP_010109227.1 hypothetical protein L484_011849 [Morus notabilis] EXC21407.1 hypothetical protein L484_011849 [Morus notabilis] Length = 841 Score = 91.7 bits (226), Expect = 1e-19 Identities = 42/68 (61%), Positives = 51/68 (75%) Frame = -1 Query: 223 FQEPISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQ 44 FQ ++S+ YASI E+C P +Q+HAH +K GFCGHEFVETKLLQ YAKCG DAA Sbjct: 41 FQRAVNSSSYASIFESCRCPDLGKQVHAHTVKTGFCGHEFVETKLLQMYAKCGRLEDAAL 100 Query: 43 LFDKMPKR 20 +F+KMP R Sbjct: 101 VFEKMPLR 108 >XP_016564327.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Capsicum annuum] Length = 837 Score = 90.5 bits (223), Expect = 4e-19 Identities = 40/64 (62%), Positives = 51/64 (79%) Frame = -1 Query: 211 ISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQLFDK 32 +SS+ YAS++++C PR +Q+HA +KNGF GHEFVETKLLQ Y KCGCF DA QLFD+ Sbjct: 48 LSSSSYASVLDSCKCPRLGKQVHAQALKNGFHGHEFVETKLLQMYGKCGCFDDAVQLFDR 107 Query: 31 MPKR 20 M +R Sbjct: 108 MRER 111 >XP_006350509.2 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Solanum tuberosum] Length = 848 Score = 89.7 bits (221), Expect = 7e-19 Identities = 40/64 (62%), Positives = 50/64 (78%) Frame = -1 Query: 211 ISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQLFDK 32 +SS+ YAS++++C P +Q+HA +KNGF GHEFVETKLLQ Y KCGCF DA QLFDK Sbjct: 59 LSSSSYASVLDSCKCPNLGKQVHAQALKNGFHGHEFVETKLLQMYGKCGCFDDAVQLFDK 118 Query: 31 MPKR 20 M +R Sbjct: 119 MRER 122 >XP_016461618.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Nicotiana tabacum] Length = 851 Score = 89.7 bits (221), Expect = 7e-19 Identities = 40/64 (62%), Positives = 49/64 (76%) Frame = -1 Query: 211 ISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQLFDK 32 ++S+ YAS++E+C PR +Q+HA +KNGF GHEFVETKLLQ Y KCGCF DA LFDK Sbjct: 62 VNSSTYASVLESCKCPRLGKQVHAQALKNGFHGHEFVETKLLQMYGKCGCFNDAVLLFDK 121 Query: 31 MPKR 20 M R Sbjct: 122 MRAR 125 >XP_009608026.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Nicotiana tomentosiformis] Length = 851 Score = 89.7 bits (221), Expect = 7e-19 Identities = 40/64 (62%), Positives = 49/64 (76%) Frame = -1 Query: 211 ISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQLFDK 32 ++S+ YAS++E+C PR +Q+HA +KNGF GHEFVETKLLQ Y KCGCF DA LFDK Sbjct: 62 VNSSTYASVLESCKCPRLGKQVHAQALKNGFHGHEFVETKLLQMYGKCGCFNDAVLLFDK 121 Query: 31 MPKR 20 M R Sbjct: 122 MRAR 125 >XP_016737289.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Gossypium hirsutum] Length = 826 Score = 88.6 bits (218), Expect = 2e-18 Identities = 40/68 (58%), Positives = 51/68 (75%) Frame = -1 Query: 223 FQEPISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQ 44 F +P+SS+ YASI+E+C++PR +Q+HAH K GF G EFV+TKLLQ Y + GC DA Sbjct: 33 FDKPVSSSTYASILESCNNPRLGKQVHAHTFKTGFSGQEFVDTKLLQMYGRFGCLGDADL 92 Query: 43 LFDKMPKR 20 LFDKM KR Sbjct: 93 LFDKMTKR 100 >XP_016437029.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Nicotiana tabacum] Length = 848 Score = 88.2 bits (217), Expect = 2e-18 Identities = 40/64 (62%), Positives = 48/64 (75%) Frame = -1 Query: 211 ISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQLFDK 32 ++S+ YAS +E+C PR +Q+HA +KNGF GHEFVETKLLQ Y KCGCF DA LFDK Sbjct: 59 VNSSTYASALESCKCPRLGKQVHAQTLKNGFHGHEFVETKLLQMYGKCGCFNDAVLLFDK 118 Query: 31 MPKR 20 M R Sbjct: 119 MRAR 122 >XP_010318041.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Solanum lycopersicum] Length = 848 Score = 88.2 bits (217), Expect = 2e-18 Identities = 39/64 (60%), Positives = 50/64 (78%) Frame = -1 Query: 211 ISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQLFDK 32 +SS+ +AS++++C P +Q+HA +KNGF GHEFVETKLLQ Y KCGCF DA QLFDK Sbjct: 59 VSSSSFASVLDSCKCPNLGKQVHAQALKNGFHGHEFVETKLLQMYGKCGCFDDAVQLFDK 118 Query: 31 MPKR 20 M +R Sbjct: 119 MLER 122 >XP_009785818.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Nicotiana sylvestris] Length = 848 Score = 88.2 bits (217), Expect = 2e-18 Identities = 40/64 (62%), Positives = 48/64 (75%) Frame = -1 Query: 211 ISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQLFDK 32 ++S+ YAS +E+C PR +Q+HA +KNGF GHEFVETKLLQ Y KCGCF DA LFDK Sbjct: 59 VNSSTYASALESCKCPRLGKQVHAQTLKNGFHGHEFVETKLLQMYGKCGCFNDAVLLFDK 118 Query: 31 MPKR 20 M R Sbjct: 119 MRAR 122 >XP_015070487.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Solanum pennellii] Length = 852 Score = 88.2 bits (217), Expect = 2e-18 Identities = 39/64 (60%), Positives = 50/64 (78%) Frame = -1 Query: 211 ISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQLFDK 32 +SS+ +AS++++C P +Q+HA +KNGF GHEFVETKLLQ Y KCGCF DA QLFDK Sbjct: 63 VSSSSFASVLDSCKCPNLGKQVHAQALKNGFHGHEFVETKLLQMYGKCGCFDDAVQLFDK 122 Query: 31 MPKR 20 M +R Sbjct: 123 MLER 126 >XP_019243938.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Nicotiana attenuata] OIT05139.1 pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 851 Score = 87.8 bits (216), Expect = 3e-18 Identities = 40/64 (62%), Positives = 48/64 (75%) Frame = -1 Query: 211 ISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQLFDK 32 ++S+ YAS +E+C PR +Q+HA +KNGF GHEFVETKLLQ Y KCGCF DA LFDK Sbjct: 62 VNSSTYASALESCKCPRLGKQVHAQALKNGFHGHEFVETKLLQMYGKCGCFNDAVFLFDK 121 Query: 31 MPKR 20 M R Sbjct: 122 MRAR 125 >OMO87916.1 hypothetical protein CCACVL1_08679 [Corchorus capsularis] Length = 828 Score = 87.4 bits (215), Expect = 4e-18 Identities = 39/66 (59%), Positives = 49/66 (74%) Frame = -1 Query: 217 EPISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQLF 38 +P+SST YASI+E+C P +Q+H+H+ K+GF GHEFV+TKLLQ Y K GC DA LF Sbjct: 35 KPVSSTTYASILESCKDPNLGKQVHSHVFKSGFFGHEFVDTKLLQMYGKFGCLEDAELLF 94 Query: 37 DKMPKR 20 DKM R Sbjct: 95 DKMTLR 100 >XP_012843139.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Erythranthe guttata] Length = 859 Score = 87.0 bits (214), Expect = 6e-18 Identities = 38/63 (60%), Positives = 50/63 (79%) Frame = -1 Query: 208 SSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQLFDKM 29 +S+ YAS++++C P+ Q+ AH+IKNGF G EFV+TKLLQ YAKCGC DAA +FDKM Sbjct: 69 NSSAYASVLDSCTCPKFGNQVQAHLIKNGFHGREFVQTKLLQMYAKCGCLDDAALVFDKM 128 Query: 28 PKR 20 P+R Sbjct: 129 PER 131 >XP_006491968.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Citrus sinensis] Length = 817 Score = 86.7 bits (213), Expect = 8e-18 Identities = 39/66 (59%), Positives = 49/66 (74%) Frame = -1 Query: 217 EPISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQLF 38 +P +S YASI+E+C P +Q+HAH IK GF GHEFVETKLLQ Y + GC DA+ +F Sbjct: 17 KPANSITYASILESCKCPNLGKQVHAHSIKTGFRGHEFVETKLLQMYGRYGCLEDASLIF 76 Query: 37 DKMPKR 20 DKMP+R Sbjct: 77 DKMPRR 82 >XP_016716420.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Gossypium hirsutum] Length = 827 Score = 86.3 bits (212), Expect = 1e-17 Identities = 39/68 (57%), Positives = 50/68 (73%) Frame = -1 Query: 223 FQEPISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQ 44 F +P+SS+ YASI+E+C++PR +Q+HAH K GF G EFV+TKLLQ Y + GC DA Sbjct: 33 FDKPVSSSTYASILESCNNPRLGKQVHAHTFKTGFSGQEFVDTKLLQMYGRFGCLGDAEL 92 Query: 43 LFDKMPKR 20 LFDKM R Sbjct: 93 LFDKMTLR 100 >XP_010267513.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Nelumbo nucifera] Length = 857 Score = 85.5 bits (210), Expect = 2e-17 Identities = 36/65 (55%), Positives = 47/65 (72%) Frame = -1 Query: 214 PISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQLFD 35 P+ ST YAS++E+C P +Q+HAH +K GFCGHEF+ETKLLQ Y +CG +A LF+ Sbjct: 62 PVDSTAYASVLESCKCPGLGKQVHAHALKTGFCGHEFLETKLLQMYGRCGSIEEARLLFE 121 Query: 34 KMPKR 20 MP R Sbjct: 122 NMPLR 126 >XP_017609027.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Gossypium arboreum] Length = 827 Score = 85.1 bits (209), Expect = 3e-17 Identities = 39/68 (57%), Positives = 50/68 (73%) Frame = -1 Query: 223 FQEPISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQ 44 F +P+SS+ YASI+E+C++PR +Q+HAH K GF G EFV+TKLLQ Y + GC DA Sbjct: 33 FDKPVSSSNYASILESCNNPRLGKQVHAHTFKTGFSGQEFVDTKLLQMYGRFGCLGDAEL 92 Query: 43 LFDKMPKR 20 LFDKM R Sbjct: 93 LFDKMTLR 100 >XP_012439962.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Gossypium raimondii] KJB52539.1 hypothetical protein B456_008G266900 [Gossypium raimondii] Length = 827 Score = 84.7 bits (208), Expect = 4e-17 Identities = 39/68 (57%), Positives = 50/68 (73%) Frame = -1 Query: 223 FQEPISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQ 44 F +P+SS+ YASI+E+C++ R +Q+HAH K GF G EFV+TKLLQ Y + GC DA Sbjct: 33 FDKPVSSSTYASILESCNNLRLGKQVHAHTFKTGFSGQEFVDTKLLQMYGRFGCLGDADL 92 Query: 43 LFDKMPKR 20 LFDKM KR Sbjct: 93 LFDKMTKR 100 >XP_007039119.2 PREDICTED: pentatricopeptide repeat-containing protein At2g13600 [Theobroma cacao] Length = 831 Score = 84.3 bits (207), Expect = 5e-17 Identities = 41/66 (62%), Positives = 48/66 (72%) Frame = -1 Query: 217 EPISSTVYASIIEACDSPRGCRQIHAHIIKNGFCGHEFVETKLLQAYAKCGCFLDAAQLF 38 +PISST YASI+EAC+ P +Q+HAH +K GF HEFV+TKLLQ YAK G DA LF Sbjct: 39 KPISSTAYASILEACNDPSLGKQVHAHTLKTGFFAHEFVDTKLLQMYAKFGSLEDADLLF 98 Query: 37 DKMPKR 20 DKM R Sbjct: 99 DKMALR 104