BLASTX nr result
ID: Lithospermum23_contig00023847
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00023847 (259 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016505486.1 PREDICTED: probable cinnamyl alcohol dehydrogenas... 89 4e-19 XP_009589196.1 PREDICTED: probable cinnamyl alcohol dehydrogenas... 89 4e-19 XP_018729320.1 PREDICTED: probable cinnamyl alcohol dehydrogenas... 88 1e-18 XP_010056079.1 PREDICTED: probable cinnamyl alcohol dehydrogenas... 88 1e-18 XP_010056081.1 PREDICTED: probable cinnamyl alcohol dehydrogenas... 88 1e-18 XP_016478313.1 PREDICTED: probable cinnamyl alcohol dehydrogenas... 87 1e-18 XP_009778632.1 PREDICTED: probable cinnamyl alcohol dehydrogenas... 87 1e-18 KCW45120.1 hypothetical protein EUGRSUZ_L01279 [Eucalyptus grandis] 84 2e-18 KCW72669.1 hypothetical protein EUGRSUZ_E01119 [Eucalyptus grandis] 86 2e-18 XP_010040547.1 PREDICTED: probable cinnamyl alcohol dehydrogenas... 84 2e-18 XP_010056072.1 PREDICTED: probable cinnamyl alcohol dehydrogenas... 86 3e-18 XP_019259482.1 PREDICTED: probable cinnamyl alcohol dehydrogenas... 86 4e-18 XP_010056069.1 PREDICTED: probable cinnamyl alcohol dehydrogenas... 86 4e-18 KCW72651.1 hypothetical protein EUGRSUZ_E01107 [Eucalyptus grandis] 86 4e-18 KCW45115.1 hypothetical protein EUGRSUZ_L01277 [Eucalyptus grand... 86 5e-18 XP_018729334.1 PREDICTED: probable cinnamyl alcohol dehydrogenas... 86 5e-18 XP_010056089.1 PREDICTED: probable cinnamyl alcohol dehydrogenas... 86 5e-18 XP_018729321.1 PREDICTED: probable cinnamyl alcohol dehydrogenas... 86 5e-18 XP_018729341.1 PREDICTED: probable cinnamyl alcohol dehydrogenas... 86 7e-18 KCW72659.1 hypothetical protein EUGRSUZ_E01117 [Eucalyptus grandis] 86 7e-18 >XP_016505486.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Nicotiana tabacum] XP_016505494.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Nicotiana tabacum] Length = 355 Score = 89.0 bits (219), Expect = 4e-19 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 M+ ENC GWAARDPSGFLSPYKFSRRAVG+DDV LDIAFCG+C+AD Sbjct: 1 MTSASAAENCLGWAARDPSGFLSPYKFSRRAVGSDDVLLDIAFCGICFAD 50 >XP_009589196.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Nicotiana tomentosiformis] XP_009589197.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Nicotiana tomentosiformis] Length = 355 Score = 89.0 bits (219), Expect = 4e-19 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 M+ ENC GWAARDPSGFLSPYKFSRRAVG+DDV LDIAFCG+C+AD Sbjct: 1 MTSASAAENCLGWAARDPSGFLSPYKFSRRAVGSDDVLLDIAFCGICFAD 50 >XP_018729320.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X2 [Eucalyptus grandis] Length = 367 Score = 87.8 bits (216), Expect = 1e-18 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = +1 Query: 106 KMSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 KMS EG E+C GWAARDPSGFLSPYKF+RRAVG++DVS+ I CGVCYAD Sbjct: 13 KMSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYAD 63 >XP_010056079.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X1 [Eucalyptus grandis] KCW72664.1 hypothetical protein EUGRSUZ_E01119 [Eucalyptus grandis] Length = 369 Score = 87.8 bits (216), Expect = 1e-18 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = +1 Query: 106 KMSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 KMS EG E+C GWAARDPSGFLSPYKF+RRAVG++DVS+ I CGVCYAD Sbjct: 15 KMSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYAD 65 >XP_010056081.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X1 [Eucalyptus grandis] XP_010056082.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X1 [Eucalyptus grandis] KCW72660.1 hypothetical protein EUGRSUZ_E01117 [Eucalyptus grandis] Length = 369 Score = 87.8 bits (216), Expect = 1e-18 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = +1 Query: 106 KMSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 KMS EG E+C GWAARDPSGFLSPYKF+RRAVG++DVS+ I CGVCYAD Sbjct: 15 KMSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYAD 65 >XP_016478313.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Nicotiana tabacum] XP_016478317.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Nicotiana tabacum] Length = 355 Score = 87.4 bits (215), Expect = 1e-18 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 M+ V ENC GWAARDPSGFLSPYKFSRR VG+DDV LDI FCG+C+AD Sbjct: 1 MTSASVKENCLGWAARDPSGFLSPYKFSRRTVGSDDVLLDILFCGICFAD 50 >XP_009778632.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Nicotiana sylvestris] XP_009778633.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Nicotiana sylvestris] Length = 355 Score = 87.4 bits (215), Expect = 1e-18 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 M+ V ENC GWAARDPSGFLSPYKFSRR VG+DDV LDI FCG+C+AD Sbjct: 1 MTSASVKENCLGWAARDPSGFLSPYKFSRRTVGSDDVLLDILFCGICFAD 50 >KCW45120.1 hypothetical protein EUGRSUZ_L01279 [Eucalyptus grandis] Length = 187 Score = 84.3 bits (207), Expect = 2e-18 Identities = 38/50 (76%), Positives = 41/50 (82%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 MS EG E+C GWAARDPSG LSPYKFSRR VG+DDVS+ I CGVCYAD Sbjct: 1 MSSEGAKEDCLGWAARDPSGRLSPYKFSRRTVGSDDVSIRITHCGVCYAD 50 >KCW72669.1 hypothetical protein EUGRSUZ_E01119 [Eucalyptus grandis] Length = 259 Score = 85.9 bits (211), Expect = 2e-18 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 MS EG E+C GWAARDPSGFLSPYKF+RRAVG++DVS+ I CGVCYAD Sbjct: 1 MSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYAD 50 >XP_010040547.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus grandis] XP_018722188.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus grandis] XP_018722189.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus grandis] Length = 192 Score = 84.3 bits (207), Expect = 2e-18 Identities = 38/50 (76%), Positives = 41/50 (82%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 MS EG E+C GWAARDPSG LSPYKFSRR VG+DDVS+ I CGVCYAD Sbjct: 1 MSSEGAKEDCLGWAARDPSGRLSPYKFSRRTVGSDDVSIRITHCGVCYAD 50 >XP_010056072.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X2 [Eucalyptus grandis] Length = 284 Score = 85.5 bits (210), Expect = 3e-18 Identities = 38/50 (76%), Positives = 41/50 (82%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 MS EG E+C GWAARDPSG LSPYKFSRR VG+DDVS+ I CGVCYAD Sbjct: 1 MSSEGAKEDCLGWAARDPSGLLSPYKFSRRTVGSDDVSIRITHCGVCYAD 50 >XP_019259482.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Nicotiana attenuata] XP_019259483.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Nicotiana attenuata] OIT39810.1 putative cinnamyl alcohol dehydrogenase 1 [Nicotiana attenuata] Length = 355 Score = 86.3 bits (212), Expect = 4e-18 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 M+ ENC GWAARDPSGFLSPYKFSRR VG+DDV LDI FCG+C+AD Sbjct: 1 MTSASAEENCLGWAARDPSGFLSPYKFSRRTVGSDDVLLDILFCGICFAD 50 >XP_010056069.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus grandis] KCW72647.1 hypothetical protein EUGRSUZ_E01103 [Eucalyptus grandis] Length = 355 Score = 86.3 bits (212), Expect = 4e-18 Identities = 39/50 (78%), Positives = 41/50 (82%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 MS EGV E+C GWAARDPSG LSPYKFSRR VG DDVS+ I CGVCYAD Sbjct: 1 MSSEGVKEDCLGWAARDPSGLLSPYKFSRRTVGRDDVSIRITHCGVCYAD 50 >KCW72651.1 hypothetical protein EUGRSUZ_E01107 [Eucalyptus grandis] Length = 323 Score = 85.9 bits (211), Expect = 4e-18 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 MS EG E+C GWAARDPSGFLSPYKF+RRAVG++DVS+ I CGVCYAD Sbjct: 1 MSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYAD 50 >KCW45115.1 hypothetical protein EUGRSUZ_L01277 [Eucalyptus grandis] KCW45116.1 hypothetical protein EUGRSUZ_L01277 [Eucalyptus grandis] KCW45117.1 hypothetical protein EUGRSUZ_L01277 [Eucalyptus grandis] KCW45118.1 hypothetical protein EUGRSUZ_L01277 [Eucalyptus grandis] Length = 345 Score = 85.9 bits (211), Expect = 5e-18 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 MS EG E+C GWAARDPSGFLSPYKF+RRAVG++DVS+ I CGVCYAD Sbjct: 1 MSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYAD 50 >XP_018729334.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X2 [Eucalyptus grandis] XP_018729335.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X2 [Eucalyptus grandis] XP_018729336.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X2 [Eucalyptus grandis] XP_018729337.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X2 [Eucalyptus grandis] KCW72661.1 hypothetical protein EUGRSUZ_E01117 [Eucalyptus grandis] KCW72662.1 hypothetical protein EUGRSUZ_E01117 [Eucalyptus grandis] KCW72663.1 hypothetical protein EUGRSUZ_E01117 [Eucalyptus grandis] Length = 354 Score = 85.9 bits (211), Expect = 5e-18 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 MS EG E+C GWAARDPSGFLSPYKF+RRAVG++DVS+ I CGVCYAD Sbjct: 1 MSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYAD 50 >XP_010056089.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus grandis] XP_010056090.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus grandis] XP_010056092.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus grandis] XP_010056093.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus grandis] KCW72653.1 hypothetical protein EUGRSUZ_E01110 [Eucalyptus grandis] KCW72654.1 hypothetical protein EUGRSUZ_E01110 [Eucalyptus grandis] Length = 354 Score = 85.9 bits (211), Expect = 5e-18 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 MS EG E+C GWAARDPSGFLSPYKF+RRAVG++DVS+ I CGVCYAD Sbjct: 1 MSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYAD 50 >XP_018729321.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X3 [Eucalyptus grandis] XP_018729322.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X3 [Eucalyptus grandis] XP_018729323.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X3 [Eucalyptus grandis] XP_018729324.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X3 [Eucalyptus grandis] XP_018729325.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X3 [Eucalyptus grandis] XP_018729326.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X3 [Eucalyptus grandis] XP_018729327.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X3 [Eucalyptus grandis] XP_018729328.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X3 [Eucalyptus grandis] XP_018729329.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X3 [Eucalyptus grandis] XP_018729330.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X3 [Eucalyptus grandis] XP_018729331.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X3 [Eucalyptus grandis] XP_018729332.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X3 [Eucalyptus grandis] XP_018729333.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform X3 [Eucalyptus grandis] KCW72665.1 hypothetical protein EUGRSUZ_E01119 [Eucalyptus grandis] KCW72666.1 hypothetical protein EUGRSUZ_E01119 [Eucalyptus grandis] KCW72667.1 hypothetical protein EUGRSUZ_E01119 [Eucalyptus grandis] KCW72668.1 hypothetical protein EUGRSUZ_E01119 [Eucalyptus grandis] Length = 354 Score = 85.9 bits (211), Expect = 5e-18 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 MS EG E+C GWAARDPSGFLSPYKF+RRAVG++DVS+ I CGVCYAD Sbjct: 1 MSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYAD 50 >XP_018729341.1 PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus grandis] Length = 353 Score = 85.5 bits (210), Expect = 7e-18 Identities = 38/50 (76%), Positives = 41/50 (82%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 MS EG E+C GWAARDPSG LSPYKFSRR VG+DDVS+ I CGVCYAD Sbjct: 1 MSSEGAKEDCLGWAARDPSGLLSPYKFSRRTVGSDDVSIRITHCGVCYAD 50 >KCW72659.1 hypothetical protein EUGRSUZ_E01117 [Eucalyptus grandis] Length = 354 Score = 85.5 bits (210), Expect = 7e-18 Identities = 38/50 (76%), Positives = 41/50 (82%) Frame = +1 Query: 109 MSDEGVHENCNGWAARDPSGFLSPYKFSRRAVGTDDVSLDIAFCGVCYAD 258 MS EG E+C GWAARDPSG LSPYKFSRR VG+DDVS+ I CGVCYAD Sbjct: 1 MSSEGAKEDCLGWAARDPSGLLSPYKFSRRTVGSDDVSIRITHCGVCYAD 50