BLASTX nr result
ID: Lithospermum23_contig00023757
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00023757 (374 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011082543.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 86 2e-17 XP_011079801.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 86 2e-17 XP_012832653.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 86 2e-17 XP_019240194.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 86 2e-17 XP_009599207.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 86 2e-17 XP_019098713.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 81 2e-17 OAY81064.1 BTB/POZ and MATH domain-containing protein 2, partial... 82 4e-17 XP_015088180.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 86 4e-17 XP_010326625.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 86 4e-17 XP_019059086.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 84 7e-17 XP_016565603.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 85 8e-17 KDO68823.1 hypothetical protein CISIN_1g015430mg [Citrus sinensis] 84 1e-16 XP_006444138.1 hypothetical protein CICLE_v10020406mg [Citrus cl... 84 1e-16 GAV78722.1 BTB domain-containing protein/MATH domain-containing ... 84 1e-16 XP_018432842.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 84 2e-16 CDP03595.1 unnamed protein product [Coffea canephora] 84 2e-16 XP_010551778.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 84 2e-16 XP_010551779.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 84 2e-16 XP_019097034.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 82 2e-16 XP_019092862.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 82 2e-16 >XP_011082543.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Sesamum indicum] Length = 410 Score = 86.3 bits (212), Expect = 2e-17 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 HDFKITGYSLSKG+G+GKYIASDTFMVGGY WA+YFYPDG Sbjct: 40 HDFKITGYSLSKGIGIGKYIASDTFMVGGYAWAIYFYPDG 79 >XP_011079801.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Sesamum indicum] Length = 410 Score = 86.3 bits (212), Expect = 2e-17 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 HDFKITGYSLSKG+G+GKYIASDTFMVGGY WA+YFYPDG Sbjct: 40 HDFKITGYSLSKGIGIGKYIASDTFMVGGYAWAIYFYPDG 79 >XP_012832653.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Erythranthe guttata] EYU46623.1 hypothetical protein MIMGU_mgv1a007354mg [Erythranthe guttata] Length = 410 Score = 86.3 bits (212), Expect = 2e-17 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 HDFKITGYSLSKG+G+GKYIASDTFMVGGY WA+YFYPDG Sbjct: 40 HDFKITGYSLSKGIGIGKYIASDTFMVGGYAWAIYFYPDG 79 >XP_019240194.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Nicotiana attenuata] OIT20425.1 btbpoz and math domain-containing protein 2 [Nicotiana attenuata] Length = 411 Score = 86.3 bits (212), Expect = 2e-17 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 HDFKITGYSLSKG+G+GKYIASDTFMVGGY WA+YFYPDG Sbjct: 41 HDFKITGYSLSKGIGIGKYIASDTFMVGGYSWAIYFYPDG 80 >XP_009599207.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Nicotiana tomentosiformis] XP_016436729.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Nicotiana tabacum] Length = 411 Score = 86.3 bits (212), Expect = 2e-17 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 HDFKITGYSLSKG+G+GKYIASDTFMVGGY WA+YFYPDG Sbjct: 41 HDFKITGYSLSKGIGIGKYIASDTFMVGGYSWAIYFYPDG 80 >XP_019098713.1 PREDICTED: BTB/POZ and MATH domain-containing protein 1-like, partial [Camelina sativa] Length = 115 Score = 80.9 bits (198), Expect = 2e-17 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 H+FKI GYSL+KG+GVGKY+ASDTFM+GGY WA+YFYPDG Sbjct: 17 HEFKICGYSLAKGVGVGKYVASDTFMIGGYSWAIYFYPDG 56 >OAY81064.1 BTB/POZ and MATH domain-containing protein 2, partial [Ananas comosus] Length = 173 Score = 82.0 bits (201), Expect = 4e-17 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 H FKITGYSLSKGMG+GKYIASDTF VGGY WA+YFYPDG Sbjct: 49 HHFKITGYSLSKGMGIGKYIASDTFTVGGYEWAIYFYPDG 88 >XP_015088180.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Solanum pennellii] Length = 411 Score = 85.5 bits (210), Expect = 4e-17 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 HDFKITGYSLSKG+G+GKYIASDTFMVGGY WA+YFYPDG Sbjct: 41 HDFKITGYSLSKGIGIGKYIASDTFMVGGYTWAIYFYPDG 80 >XP_010326625.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Solanum lycopersicum] Length = 412 Score = 85.5 bits (210), Expect = 4e-17 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 HDFKITGYSLSKG+G+GKYIASDTFMVGGY WA+YFYPDG Sbjct: 42 HDFKITGYSLSKGIGIGKYIASDTFMVGGYTWAIYFYPDG 81 >XP_019059086.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2-like isoform X2 [Tarenaya hassleriana] XP_019059087.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2-like isoform X2 [Tarenaya hassleriana] Length = 282 Score = 83.6 bits (205), Expect = 7e-17 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 H+FKI+GYSL+KGMG+GKY+ASDTFMVGGY WAVYFYPDG Sbjct: 35 HEFKISGYSLAKGMGIGKYVASDTFMVGGYSWAVYFYPDG 74 >XP_016565603.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Capsicum annuum] Length = 412 Score = 84.7 bits (208), Expect = 8e-17 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 HDF ITGYSLSKG+G+GKYIASDTFMVGGY WAVYFYPDG Sbjct: 42 HDFNITGYSLSKGIGIGKYIASDTFMVGGYSWAVYFYPDG 81 >KDO68823.1 hypothetical protein CISIN_1g015430mg [Citrus sinensis] Length = 399 Score = 84.3 bits (207), Expect = 1e-16 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 H FKITGYSLSKG+G+GKYIASDTFMVGGY WA+YFYPDG Sbjct: 37 HQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDG 76 >XP_006444138.1 hypothetical protein CICLE_v10020406mg [Citrus clementina] XP_006479773.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Citrus sinensis] ESR57378.1 hypothetical protein CICLE_v10020406mg [Citrus clementina] KDO68822.1 hypothetical protein CISIN_1g015430mg [Citrus sinensis] Length = 407 Score = 84.3 bits (207), Expect = 1e-16 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 H FKITGYSLSKG+G+GKYIASDTFMVGGY WA+YFYPDG Sbjct: 37 HQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDG 76 >GAV78722.1 BTB domain-containing protein/MATH domain-containing protein [Cephalotus follicularis] Length = 412 Score = 84.3 bits (207), Expect = 1e-16 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 H FKITGYSLSKG+G+GKYIASDTFMVGGY WA+YFYPDG Sbjct: 42 HQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDG 81 >XP_018432842.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Raphanus sativus] Length = 400 Score = 83.6 bits (205), Expect = 2e-16 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 H+FKI+GYSL+KGMG+GKY+ASDTFMVGGY WAVYFYPDG Sbjct: 33 HEFKISGYSLAKGMGIGKYVASDTFMVGGYSWAVYFYPDG 72 >CDP03595.1 unnamed protein product [Coffea canephora] Length = 409 Score = 83.6 bits (205), Expect = 2e-16 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 HDFKITGYSLSKG+G+GKY+ASD FMVGGY WA+YFYPDG Sbjct: 39 HDFKITGYSLSKGIGIGKYVASDIFMVGGYAWAIYFYPDG 78 >XP_010551778.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2-like isoform X1 [Tarenaya hassleriana] Length = 410 Score = 83.6 bits (205), Expect = 2e-16 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 H+FKI+GYSL+KGMG+GKY+ASDTFMVGGY WAVYFYPDG Sbjct: 35 HEFKISGYSLAKGMGIGKYVASDTFMVGGYSWAVYFYPDG 74 >XP_010551779.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2-like isoform X3 [Tarenaya hassleriana] Length = 448 Score = 83.6 bits (205), Expect = 2e-16 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 H+FKI+GYSL+KGMG+GKY+ASDTFMVGGY WAVYFYPDG Sbjct: 35 HEFKISGYSLAKGMGIGKYVASDTFMVGGYSWAVYFYPDG 74 >XP_019097034.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2-like isoform X2 [Camelina sativa] Length = 276 Score = 82.0 bits (201), Expect = 2e-16 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 H+FKI+GYSL KGMG+GKY+ASDTFMVGGY WA+YFYPDG Sbjct: 35 HEFKISGYSLVKGMGIGKYVASDTFMVGGYSWAIYFYPDG 74 >XP_019092862.1 PREDICTED: BTB/POZ and MATH domain-containing protein 2-like isoform X2 [Camelina sativa] Length = 276 Score = 82.0 bits (201), Expect = 2e-16 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 H+FKI+GYSL KGMG+GKY+ASDTFMVGGY WA+YFYPDG Sbjct: 35 HEFKISGYSLVKGMGIGKYVASDTFMVGGYSWAIYFYPDG 74