BLASTX nr result
ID: Lithospermum23_contig00023637
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00023637 (193 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002317465.1 tetratricopeptide repeat-containing family protei... 53 1e-06 XP_018731419.1 PREDICTED: TPR repeat-containing thioredoxin TTL1... 53 1e-06 KCW67491.1 hypothetical protein EUGRSUZ_F01225 [Eucalyptus grandis] 53 1e-06 XP_017247929.1 PREDICTED: TPR repeat-containing thioredoxin TTL1... 53 2e-06 XP_008382055.1 PREDICTED: TPR repeat-containing thioredoxin TTL1... 52 3e-06 XP_009340082.1 PREDICTED: TPR repeat-containing thioredoxin TTL1... 52 4e-06 XP_008359330.1 PREDICTED: TPR repeat-containing thioredoxin TTL1... 51 7e-06 XP_009335179.1 PREDICTED: TPR repeat-containing thioredoxin TTL1... 51 9e-06 XP_018499769.1 PREDICTED: TPR repeat-containing thioredoxin TTL1... 51 9e-06 XP_010552115.1 PREDICTED: TPR repeat-containing thioredoxin TTL1... 51 9e-06 >XP_002317465.1 tetratricopeptide repeat-containing family protein [Populus trichocarpa] EEE98077.1 tetratricopeptide repeat-containing family protein [Populus trichocarpa] Length = 698 Score = 53.1 bits (126), Expect = 1e-06 Identities = 32/64 (50%), Positives = 40/64 (62%) Frame = +2 Query: 2 KFGWKVEFVLLLEQFRAAVSSPSKISLIMEHCNALICST*LSLFDTKCKQLSQFLTTLCS 181 KFG +VE VL EQFRAA+S P K SL C +++ S + CKQ+S F+ TLC Sbjct: 585 KFGGEVEEVLGFEQFRAAISLPGKSSL---SCVSVVHFK--SSSNVHCKQISPFVDTLCG 639 Query: 182 RYPS 193 RYPS Sbjct: 640 RYPS 643 >XP_018731419.1 PREDICTED: TPR repeat-containing thioredoxin TTL1, partial [Eucalyptus grandis] Length = 752 Score = 53.1 bits (126), Expect = 1e-06 Identities = 32/64 (50%), Positives = 42/64 (65%) Frame = +2 Query: 2 KFGWKVEFVLLLEQFRAAVSSPSKISLIMEHCNALICST*LSLFDTKCKQLSQFLTTLCS 181 KFG +VE VL LEQF+AA+S P +S++ H + D++CKQ+S FL TLCS Sbjct: 645 KFGGEVEEVLGLEQFKAAISLPG-VSVV--HFK--------TASDSQCKQMSSFLDTLCS 693 Query: 182 RYPS 193 RYPS Sbjct: 694 RYPS 697 >KCW67491.1 hypothetical protein EUGRSUZ_F01225 [Eucalyptus grandis] Length = 814 Score = 53.1 bits (126), Expect = 1e-06 Identities = 32/64 (50%), Positives = 42/64 (65%) Frame = +2 Query: 2 KFGWKVEFVLLLEQFRAAVSSPSKISLIMEHCNALICST*LSLFDTKCKQLSQFLTTLCS 181 KFG +VE VL LEQF+AA+S P +S++ H + D++CKQ+S FL TLCS Sbjct: 707 KFGGEVEEVLGLEQFKAAISLPG-VSVV--HFK--------TASDSQCKQMSSFLDTLCS 755 Query: 182 RYPS 193 RYPS Sbjct: 756 RYPS 759 >XP_017247929.1 PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Daucus carota subsp. sativus] KZM99491.1 hypothetical protein DCAR_013147 [Daucus carota subsp. sativus] Length = 698 Score = 52.8 bits (125), Expect = 2e-06 Identities = 31/64 (48%), Positives = 37/64 (57%) Frame = +2 Query: 2 KFGWKVEFVLLLEQFRAAVSSPSKISLIMEHCNALICST*LSLFDTKCKQLSQFLTTLCS 181 KFG VE V LEQFRAA+SSPS + + S D +C Q+S F+ TLCS Sbjct: 591 KFGGDVELVSGLEQFRAAISSPSASVVHFK-----------SASDLQCNQISPFVDTLCS 639 Query: 182 RYPS 193 RYPS Sbjct: 640 RYPS 643 >XP_008382055.1 PREDICTED: TPR repeat-containing thioredoxin TTL1 [Malus domestica] Length = 699 Score = 52.4 bits (124), Expect = 3e-06 Identities = 32/64 (50%), Positives = 40/64 (62%) Frame = +2 Query: 2 KFGWKVEFVLLLEQFRAAVSSPSKISLIMEHCNALICST*LSLFDTKCKQLSQFLTTLCS 181 KFG +VE +L LEQFRAA+S P +S++ H A D +CKQ+S FL TLC Sbjct: 592 KFGGEVEEILGLEQFRAAISLPG-VSVV--HFKA--------ASDLQCKQISPFLDTLCG 640 Query: 182 RYPS 193 RYPS Sbjct: 641 RYPS 644 >XP_009340082.1 PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Pyrus x bretschneideri] Length = 702 Score = 52.0 bits (123), Expect = 4e-06 Identities = 32/64 (50%), Positives = 40/64 (62%) Frame = +2 Query: 2 KFGWKVEFVLLLEQFRAAVSSPSKISLIMEHCNALICST*LSLFDTKCKQLSQFLTTLCS 181 KFG +VE +L LEQFRAA+S P +S++ H A D +CKQ+S FL TLC Sbjct: 595 KFGREVEEILGLEQFRAAISLPG-VSVV--HFKAAS--------DLQCKQISPFLDTLCG 643 Query: 182 RYPS 193 RYPS Sbjct: 644 RYPS 647 >XP_008359330.1 PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Malus domestica] Length = 702 Score = 51.2 bits (121), Expect = 7e-06 Identities = 31/64 (48%), Positives = 40/64 (62%) Frame = +2 Query: 2 KFGWKVEFVLLLEQFRAAVSSPSKISLIMEHCNALICST*LSLFDTKCKQLSQFLTTLCS 181 KFG +VE +L +EQFRAA+S P +S++ H A D +CKQ+S FL TLC Sbjct: 595 KFGGEVEEILGIEQFRAAISLPG-VSVV--HFKAAS--------DLQCKQVSPFLDTLCG 643 Query: 182 RYPS 193 RYPS Sbjct: 644 RYPS 647 >XP_009335179.1 PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Pyrus x bretschneideri] Length = 699 Score = 50.8 bits (120), Expect = 9e-06 Identities = 31/64 (48%), Positives = 39/64 (60%) Frame = +2 Query: 2 KFGWKVEFVLLLEQFRAAVSSPSKISLIMEHCNALICST*LSLFDTKCKQLSQFLTTLCS 181 KFG +VE +L LEQFRA +S P +S++ H A D +CKQ+S FL TLC Sbjct: 592 KFGGEVEEILGLEQFRAVISLPG-VSVV--HFKAAS--------DLQCKQISPFLDTLCG 640 Query: 182 RYPS 193 RYPS Sbjct: 641 RYPS 644 >XP_018499769.1 PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Pyrus x bretschneideri] Length = 700 Score = 50.8 bits (120), Expect = 9e-06 Identities = 31/64 (48%), Positives = 39/64 (60%) Frame = +2 Query: 2 KFGWKVEFVLLLEQFRAAVSSPSKISLIMEHCNALICST*LSLFDTKCKQLSQFLTTLCS 181 KFG +VE +L LEQFRA +S P +S++ H A D +CKQ+S FL TLC Sbjct: 593 KFGGEVEEILGLEQFRAVISLPG-VSVV--HFKAAS--------DLQCKQISPFLDTLCG 641 Query: 182 RYPS 193 RYPS Sbjct: 642 RYPS 645 >XP_010552115.1 PREDICTED: TPR repeat-containing thioredoxin TTL1 [Tarenaya hassleriana] Length = 710 Score = 50.8 bits (120), Expect = 9e-06 Identities = 30/64 (46%), Positives = 40/64 (62%) Frame = +2 Query: 2 KFGWKVEFVLLLEQFRAAVSSPSKISLIMEHCNALICST*LSLFDTKCKQLSQFLTTLCS 181 KFG +VE V LEQFRAAVS P +S++ L D++CK++S F+ TLC+ Sbjct: 600 KFGGEVEEVSSLEQFRAAVSLPG-VSVVHF----------LKASDSRCKEISPFVDTLCT 648 Query: 182 RYPS 193 RYPS Sbjct: 649 RYPS 652