BLASTX nr result
ID: Lithospermum23_contig00023555
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00023555 (213 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012856115.1 PREDICTED: ATP-dependent zinc metalloprotease FTS... 58 1e-08 GAV77556.1 AAA domain-containing protein/Peptidase_M41 domain-co... 59 1e-08 EYU21497.1 hypothetical protein MIMGU_mgv1a001844mg [Erythranthe... 59 2e-08 XP_012856478.1 PREDICTED: ATP-dependent zinc metalloprotease Fts... 59 2e-08 XP_002278786.1 PREDICTED: probable inactive ATP-dependent zinc m... 59 2e-08 CBI36091.3 unnamed protein product, partial [Vitis vinifera] 59 2e-08 XP_016510851.1 PREDICTED: probable inactive ATP-dependent zinc m... 58 4e-08 KYP54256.1 Cell division protease ftsH isogeny 4 [Cajanus cajan] 58 4e-08 XP_020089018.1 probable inactive ATP-dependent zinc metalloprote... 58 4e-08 XP_015061113.1 PREDICTED: probable inactive ATP-dependent zinc m... 58 4e-08 XP_006359468.1 PREDICTED: probable inactive ATP-dependent zinc m... 58 4e-08 XP_004252353.1 PREDICTED: probable inactive ATP-dependent zinc m... 58 4e-08 XP_019252715.1 PREDICTED: probable inactive ATP-dependent zinc m... 58 4e-08 XP_009798719.1 PREDICTED: ATP-dependent zinc metalloprotease Fts... 58 4e-08 XP_009617332.1 PREDICTED: probable inactive ATP-dependent zinc m... 58 4e-08 XP_016550312.1 PREDICTED: probable inactive ATP-dependent zinc m... 58 4e-08 XP_010906729.1 PREDICTED: probable inactive ATP-dependent zinc m... 58 4e-08 XP_008807051.1 PREDICTED: probable inactive ATP-dependent zinc m... 58 4e-08 KZV31837.1 ATP-dependent zinc metalloprotease FtsH-like [Dorcoce... 58 4e-08 XP_018839159.1 PREDICTED: probable inactive ATP-dependent zinc m... 58 4e-08 >XP_012856115.1 PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like [Erythranthe guttata] Length = 161 Score = 57.8 bits (138), Expect = 1e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKV 118 ILD ALVRPGRFDRKIYIPKP VIG +EILKV Sbjct: 61 ILDPALVRPGRFDRKIYIPKPGVIGRVEILKV 92 >GAV77556.1 AAA domain-containing protein/Peptidase_M41 domain-containing protein [Cephalotus follicularis] Length = 881 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILDAALVRPGRFDRKIYIPKP +IG +EILKV+ Sbjct: 565 ILDAALVRPGRFDRKIYIPKPGIIGRMEILKVH 597 >EYU21497.1 hypothetical protein MIMGU_mgv1a001844mg [Erythranthe guttata] Length = 750 Score = 58.5 bits (140), Expect = 2e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP VIG +EILKV+ Sbjct: 438 ILDPALVRPGRFDRKIYIPKPGVIGRVEILKVH 470 >XP_012856478.1 PREDICTED: ATP-dependent zinc metalloprotease FtsH [Erythranthe guttata] XP_012856479.1 PREDICTED: ATP-dependent zinc metalloprotease FtsH [Erythranthe guttata] Length = 879 Score = 58.5 bits (140), Expect = 2e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP VIG +EILKV+ Sbjct: 567 ILDPALVRPGRFDRKIYIPKPGVIGRVEILKVH 599 >XP_002278786.1 PREDICTED: probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic [Vitis vinifera] XP_010654635.1 PREDICTED: probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic [Vitis vinifera] Length = 888 Score = 58.5 bits (140), Expect = 2e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP +IG IEILKV+ Sbjct: 572 ILDPALVRPGRFDRKIYIPKPGIIGRIEILKVH 604 >CBI36091.3 unnamed protein product, partial [Vitis vinifera] Length = 904 Score = 58.5 bits (140), Expect = 2e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP +IG IEILKV+ Sbjct: 588 ILDPALVRPGRFDRKIYIPKPGIIGRIEILKVH 620 >XP_016510851.1 PREDICTED: probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic [Nicotiana tabacum] Length = 687 Score = 57.8 bits (138), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP +IG IEILKV+ Sbjct: 431 ILDPALVRPGRFDRKIYIPKPGLIGRIEILKVH 463 >KYP54256.1 Cell division protease ftsH isogeny 4 [Cajanus cajan] Length = 827 Score = 57.8 bits (138), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP +IG IEILKV+ Sbjct: 511 ILDPALVRPGRFDRKIYIPKPGLIGRIEILKVH 543 >XP_020089018.1 probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic, partial [Ananas comosus] Length = 856 Score = 57.8 bits (138), Expect = 4e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP +IG +EILKV+ Sbjct: 540 ILDPALVRPGRFDRKIYIPKPSLIGRVEILKVH 572 >XP_015061113.1 PREDICTED: probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic [Solanum pennellii] XP_015061114.1 PREDICTED: probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic [Solanum pennellii] Length = 867 Score = 57.8 bits (138), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP +IG IEILKV+ Sbjct: 551 ILDPALVRPGRFDRKIYIPKPGLIGRIEILKVH 583 >XP_006359468.1 PREDICTED: probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic [Solanum tuberosum] Length = 867 Score = 57.8 bits (138), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP +IG IEILKV+ Sbjct: 551 ILDPALVRPGRFDRKIYIPKPGLIGRIEILKVH 583 >XP_004252353.1 PREDICTED: probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic [Solanum lycopersicum] XP_010314293.1 PREDICTED: probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic [Solanum lycopersicum] Length = 867 Score = 57.8 bits (138), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP +IG IEILKV+ Sbjct: 551 ILDPALVRPGRFDRKIYIPKPGLIGRIEILKVH 583 >XP_019252715.1 PREDICTED: probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic [Nicotiana attenuata] OIT08684.1 putative inactive atp-dependent zinc metalloprotease ftshi 2, chloroplastic [Nicotiana attenuata] Length = 871 Score = 57.8 bits (138), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP +IG IEILKV+ Sbjct: 555 ILDPALVRPGRFDRKIYIPKPGLIGRIEILKVH 587 >XP_009798719.1 PREDICTED: ATP-dependent zinc metalloprotease FtsH [Nicotiana sylvestris] Length = 871 Score = 57.8 bits (138), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP +IG IEILKV+ Sbjct: 555 ILDPALVRPGRFDRKIYIPKPGLIGRIEILKVH 587 >XP_009617332.1 PREDICTED: probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic [Nicotiana tomentosiformis] Length = 871 Score = 57.8 bits (138), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP +IG IEILKV+ Sbjct: 555 ILDPALVRPGRFDRKIYIPKPGLIGRIEILKVH 587 >XP_016550312.1 PREDICTED: probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic [Capsicum annuum] Length = 872 Score = 57.8 bits (138), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP +IG IEILKV+ Sbjct: 556 ILDPALVRPGRFDRKIYIPKPGLIGRIEILKVH 588 >XP_010906729.1 PREDICTED: probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic [Elaeis guineensis] Length = 873 Score = 57.8 bits (138), Expect = 4e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP +IG +EILKV+ Sbjct: 557 ILDPALVRPGRFDRKIYIPKPSLIGRVEILKVH 589 >XP_008807051.1 PREDICTED: probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic [Phoenix dactylifera] XP_008807052.1 PREDICTED: probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic [Phoenix dactylifera] Length = 874 Score = 57.8 bits (138), Expect = 4e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP +IG +EILKV+ Sbjct: 558 ILDPALVRPGRFDRKIYIPKPSLIGRVEILKVH 590 >KZV31837.1 ATP-dependent zinc metalloprotease FtsH-like [Dorcoceras hygrometricum] Length = 878 Score = 57.8 bits (138), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP +IG IEILKV+ Sbjct: 563 ILDPALVRPGRFDRKIYIPKPGLIGRIEILKVH 595 >XP_018839159.1 PREDICTED: probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic [Juglans regia] Length = 882 Score = 57.8 bits (138), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 213 ILDAALVRPGRFDRKIYIPKPRVIGCIEILKVY 115 ILD ALVRPGRFDRKIYIPKP +IG IEILKV+ Sbjct: 567 ILDPALVRPGRFDRKIYIPKPGLIGRIEILKVH 599