BLASTX nr result
ID: Lithospermum23_contig00022683
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00022683 (254 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019225088.1 PREDICTED: WD-40 repeat-containing protein MSI2-l... 76 2e-14 XP_016440099.1 PREDICTED: WD-40 repeat-containing protein MSI2-l... 76 2e-14 XP_009791634.1 PREDICTED: WD-40 repeat-containing protein MSI2-l... 76 2e-14 XP_009626746.1 PREDICTED: WD-40 repeat-containing protein MSI2-l... 76 2e-14 XP_015056913.1 PREDICTED: WD-40 repeat-containing protein MSI2-l... 75 5e-14 XP_004231043.1 PREDICTED: WD-40 repeat-containing protein MSI2 [... 75 5e-14 XP_016539964.1 PREDICTED: WD-40 repeat-containing protein MSI2-l... 75 5e-14 XP_006359699.1 PREDICTED: WD-40 repeat-containing protein MSI2-l... 75 7e-14 KZV56609.1 hypothetical protein F511_09944 [Dorcoceras hygrometr... 74 1e-13 AEW09312.1 hypothetical protein UMN_3408_01, partial [Pinus lamb... 69 4e-13 KNA16034.1 hypothetical protein SOVF_092630 [Spinacia oleracea] 72 4e-13 AFG49667.1 hypothetical protein UMN_3408_01, partial [Pinus taed... 68 9e-13 AEW09311.1 hypothetical protein UMN_3408_01, partial [Pinus radi... 68 9e-13 KHJ89066.1 hypothetical protein OESDEN_11121 [Oesophagostomum de... 70 1e-12 KHJ79386.1 hypothetical protein OESDEN_20968 [Oesophagostomum de... 66 1e-12 XP_002306184.2 hypothetical protein POPTR_0004s18130g [Populus t... 71 1e-12 XP_012081779.1 PREDICTED: WD-40 repeat-containing protein MSI3-l... 71 2e-12 XP_011046680.1 PREDICTED: WD-40 repeat-containing protein MSI2-l... 71 2e-12 EJD74473.1 hypothetical protein LOAG_18212 [Loa loa] 65 3e-12 EPS63759.1 hypothetical protein M569_11022, partial [Genlisea au... 70 3e-12 >XP_019225088.1 PREDICTED: WD-40 repeat-containing protein MSI2-like [Nicotiana attenuata] OIT32891.1 wd-40 repeat-containing protein msi2 [Nicotiana attenuata] Length = 403 Score = 76.3 bits (186), Expect = 2e-14 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 145 QSNVEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 + VEEEFSVWKKNTPLLYD+VICHALEWPSLTVQW Sbjct: 13 EEEVEEEFSVWKKNTPLLYDLVICHALEWPSLTVQW 48 >XP_016440099.1 PREDICTED: WD-40 repeat-containing protein MSI2-like [Nicotiana tabacum] Length = 403 Score = 76.3 bits (186), Expect = 2e-14 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 145 QSNVEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 + VEEEFSVWKKNTPLLYD+VICHALEWPSLTVQW Sbjct: 13 EEEVEEEFSVWKKNTPLLYDLVICHALEWPSLTVQW 48 >XP_009791634.1 PREDICTED: WD-40 repeat-containing protein MSI2-like [Nicotiana sylvestris] XP_016511067.1 PREDICTED: WD-40 repeat-containing protein MSI2-like [Nicotiana tabacum] Length = 403 Score = 76.3 bits (186), Expect = 2e-14 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 145 QSNVEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 + VEEEFSVWKKNTPLLYD+VICHALEWPSLTVQW Sbjct: 13 EEEVEEEFSVWKKNTPLLYDLVICHALEWPSLTVQW 48 >XP_009626746.1 PREDICTED: WD-40 repeat-containing protein MSI2-like [Nicotiana tomentosiformis] Length = 403 Score = 76.3 bits (186), Expect = 2e-14 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 145 QSNVEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 + VEEEFSVWKKNTPLLYD+VICHALEWPSLTVQW Sbjct: 13 EEEVEEEFSVWKKNTPLLYDLVICHALEWPSLTVQW 48 >XP_015056913.1 PREDICTED: WD-40 repeat-containing protein MSI2-like [Solanum pennellii] Length = 403 Score = 75.1 bits (183), Expect = 5e-14 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +1 Query: 145 QSNVEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 + +VEEEF+VWKKNTPLLYD+V+CHALEWPSLTVQW Sbjct: 13 EQDVEEEFAVWKKNTPLLYDLVVCHALEWPSLTVQW 48 >XP_004231043.1 PREDICTED: WD-40 repeat-containing protein MSI2 [Solanum lycopersicum] Length = 403 Score = 75.1 bits (183), Expect = 5e-14 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +1 Query: 145 QSNVEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 + +VEEEF+VWKKNTPLLYD+V+CHALEWPSLTVQW Sbjct: 13 EQDVEEEFAVWKKNTPLLYDLVVCHALEWPSLTVQW 48 >XP_016539964.1 PREDICTED: WD-40 repeat-containing protein MSI2-like [Capsicum annuum] Length = 404 Score = 75.1 bits (183), Expect = 5e-14 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 145 QSNVEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 + VEEEF+VWKKNTPLLYD+VICHALEWPSLTVQW Sbjct: 14 EQEVEEEFAVWKKNTPLLYDLVICHALEWPSLTVQW 49 >XP_006359699.1 PREDICTED: WD-40 repeat-containing protein MSI2-like [Solanum tuberosum] Length = 403 Score = 74.7 bits (182), Expect = 7e-14 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +1 Query: 145 QSNVEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 + VEEEF+VWKKNTPLLYD+V+CHALEWPSLTVQW Sbjct: 13 EQEVEEEFAVWKKNTPLLYDLVVCHALEWPSLTVQW 48 >KZV56609.1 hypothetical protein F511_09944 [Dorcoceras hygrometricum] Length = 393 Score = 73.9 bits (180), Expect = 1e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 154 VEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 VEEEFSVWKKNTPLLYD+V+CH+LEWPSLTVQW Sbjct: 5 VEEEFSVWKKNTPLLYDLVVCHSLEWPSLTVQW 37 >AEW09312.1 hypothetical protein UMN_3408_01, partial [Pinus lambertiana] AFB34719.1 hypothetical protein UMN_3408_01, partial [Pinus cembra] AFB34720.1 hypothetical protein UMN_3408_01, partial [Pinus cembra] AFB34721.1 hypothetical protein UMN_3408_01, partial [Pinus cembra] AFB34722.1 hypothetical protein UMN_3408_01, partial [Pinus cembra] AFB34723.1 hypothetical protein UMN_3408_01, partial [Pinus cembra] AFB34724.1 hypothetical protein UMN_3408_01, partial [Pinus cembra] AFB34725.1 hypothetical protein UMN_3408_01, partial [Pinus cembra] AFB34726.1 hypothetical protein UMN_3408_01, partial [Pinus cembra] AFB34727.1 hypothetical protein UMN_3408_01, partial [Pinus cembra] AFB34728.1 hypothetical protein UMN_3408_01, partial [Pinus cembra] Length = 118 Score = 68.6 bits (166), Expect = 4e-13 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +1 Query: 121 GEDLYTMAQSNVEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 GE M + V EE+ +WKKNTP LYD+VI HALEWPSLTVQW Sbjct: 7 GESRDEMGERMVNEEYKIWKKNTPFLYDLVITHALEWPSLTVQW 50 >KNA16034.1 hypothetical protein SOVF_092630 [Spinacia oleracea] Length = 396 Score = 72.4 bits (176), Expect = 4e-13 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = +1 Query: 115 LAGEDLYTMAQSNVEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 +A E+ M + + EEF+VWKKNTP+LYD+V+CH LEWPSLTVQW Sbjct: 1 MAEEEETEMTEQQLNEEFAVWKKNTPILYDLVLCHPLEWPSLTVQW 46 >AFG49667.1 hypothetical protein UMN_3408_01, partial [Pinus taeda] AFG49668.1 hypothetical protein UMN_3408_01, partial [Pinus taeda] Length = 118 Score = 67.8 bits (164), Expect = 9e-13 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +1 Query: 121 GEDLYTMAQSNVEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 GE M + V EE+ +WKKNTP LYD+VI HALEWPSLTVQW Sbjct: 7 GESRDEMGERMVNEEYKLWKKNTPFLYDLVITHALEWPSLTVQW 50 >AEW09311.1 hypothetical protein UMN_3408_01, partial [Pinus radiata] AFB34729.1 hypothetical protein UMN_3408_01, partial [Pinus mugo] AFB34730.1 hypothetical protein UMN_3408_01, partial [Pinus mugo] AFB34731.1 hypothetical protein UMN_3408_01, partial [Pinus mugo] AFB34732.1 hypothetical protein UMN_3408_01, partial [Pinus mugo] AFB34733.1 hypothetical protein UMN_3408_01, partial [Pinus mugo] AFB34734.1 hypothetical protein UMN_3408_01, partial [Pinus mugo] AFB34735.1 hypothetical protein UMN_3408_01, partial [Pinus mugo] AFB34736.1 hypothetical protein UMN_3408_01, partial [Pinus mugo] AFG49664.1 hypothetical protein UMN_3408_01, partial [Pinus taeda] AFG49665.1 hypothetical protein UMN_3408_01, partial [Pinus taeda] AFG49666.1 hypothetical protein UMN_3408_01, partial [Pinus taeda] AFG49669.1 hypothetical protein UMN_3408_01, partial [Pinus taeda] AFG49670.1 hypothetical protein UMN_3408_01, partial [Pinus taeda] AFG49671.1 hypothetical protein UMN_3408_01, partial [Pinus taeda] AFG49672.1 hypothetical protein UMN_3408_01, partial [Pinus taeda] AFG49673.1 hypothetical protein UMN_3408_01, partial [Pinus taeda] Length = 118 Score = 67.8 bits (164), Expect = 9e-13 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +1 Query: 121 GEDLYTMAQSNVEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 GE M + V EE+ +WKKNTP LYD+VI HALEWPSLTVQW Sbjct: 7 GESRDEMGERMVNEEYKLWKKNTPFLYDLVITHALEWPSLTVQW 50 >KHJ89066.1 hypothetical protein OESDEN_11121 [Oesophagostomum dentatum] Length = 216 Score = 69.7 bits (169), Expect = 1e-12 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 13/73 (17%) Frame = +1 Query: 73 AWKPISPVGGYLGYLAGEDLYTMAQSN-------------VEEEFSVWKKNTPLLYDMVI 213 A+ ++P G LG + D+ + + SN + EE+ +WKKNTP LYDMV+ Sbjct: 22 AFCKVTPGKGKLGITSPRDILSFSDSNMVEASDGSMEEKVINEEYKIWKKNTPFLYDMVM 81 Query: 214 CHALEWPSLTVQW 252 HALEWPSLTVQW Sbjct: 82 THALEWPSLTVQW 94 >KHJ79386.1 hypothetical protein OESDEN_20968 [Oesophagostomum dentatum] Length = 72 Score = 66.2 bits (160), Expect = 1e-12 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +1 Query: 136 TMAQSNVEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 +M + + EE+ +WKKNTP LYDMV+ HALEWPSLTVQW Sbjct: 25 SMEEKVINEEYKIWKKNTPFLYDMVMTHALEWPSLTVQW 63 >XP_002306184.2 hypothetical protein POPTR_0004s18130g [Populus trichocarpa] EEE86695.2 hypothetical protein POPTR_0004s18130g [Populus trichocarpa] Length = 417 Score = 71.2 bits (173), Expect = 1e-12 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = +1 Query: 118 AGEDLYTMAQSNVEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 A ED Q ++EEFSVWKKNTP+LYD+VI H LEWPSLTVQW Sbjct: 3 AAEDDQEAGQDQLDEEFSVWKKNTPVLYDLVISHPLEWPSLTVQW 47 >XP_012081779.1 PREDICTED: WD-40 repeat-containing protein MSI3-like [Jatropha curcas] KDP29661.1 hypothetical protein JCGZ_18823 [Jatropha curcas] Length = 408 Score = 70.9 bits (172), Expect = 2e-12 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +1 Query: 115 LAGEDLYTMAQSNVEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 +A E+ VEEEFSVWKKNTP LYD+VI H LEWPSLTVQW Sbjct: 1 MAAEEEQEQTPEQVEEEFSVWKKNTPFLYDLVISHPLEWPSLTVQW 46 >XP_011046680.1 PREDICTED: WD-40 repeat-containing protein MSI2-like [Populus euphratica] Length = 417 Score = 70.9 bits (172), Expect = 2e-12 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = +1 Query: 118 AGEDLYTMAQSNVEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 A ED Q ++EEFSVWKKNTP LYD+VI H LEWPSLTVQW Sbjct: 3 AAEDDQEAGQDQLDEEFSVWKKNTPFLYDLVISHPLEWPSLTVQW 47 >EJD74473.1 hypothetical protein LOAG_18212 [Loa loa] Length = 52 Score = 64.7 bits (156), Expect = 3e-12 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 154 VEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 + EE+ +WKKNTP LYDMV+ HALEWPSLTVQW Sbjct: 11 INEEYKIWKKNTPFLYDMVMTHALEWPSLTVQW 43 >EPS63759.1 hypothetical protein M569_11022, partial [Genlisea aurea] Length = 390 Score = 70.1 bits (170), Expect = 3e-12 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 154 VEEEFSVWKKNTPLLYDMVICHALEWPSLTVQW 252 VEEEFSVWKKNTPLLYD+++ HALEWPSLTVQW Sbjct: 3 VEEEFSVWKKNTPLLYDLLVSHALEWPSLTVQW 35