BLASTX nr result
ID: Lithospermum23_contig00022234
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00022234 (251 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013458448.1 MAP kinase kinase [Medicago truncatula] KEH32479.... 52 7e-06 CAC69138.1 MAP kinase kinase [Medicago sativa subsp. x varia] 52 7e-06 XP_013458446.1 MAP kinase kinase [Medicago truncatula] KEH32477.... 52 7e-06 XP_009609827.1 PREDICTED: mitogen-activated protein kinase kinas... 50 1e-05 >XP_013458448.1 MAP kinase kinase [Medicago truncatula] KEH32479.1 MAP kinase kinase [Medicago truncatula] Length = 356 Score = 52.0 bits (123), Expect = 7e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +3 Query: 153 MKKGALALNLKLSVPQSDQVVISNFLTESGTFK 251 MKKG L L LKLSVPQ+DQV + FLTESGTFK Sbjct: 1 MKKGNLGLGLKLSVPQTDQVAFAKFLTESGTFK 33 >CAC69138.1 MAP kinase kinase [Medicago sativa subsp. x varia] Length = 356 Score = 52.0 bits (123), Expect = 7e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +3 Query: 153 MKKGALALNLKLSVPQSDQVVISNFLTESGTFK 251 MKKG L L LKLSVPQ+DQV + FLTESGTFK Sbjct: 1 MKKGNLGLGLKLSVPQTDQVAFAKFLTESGTFK 33 >XP_013458446.1 MAP kinase kinase [Medicago truncatula] KEH32477.1 MAP kinase kinase [Medicago truncatula] Length = 379 Score = 52.0 bits (123), Expect = 7e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +3 Query: 153 MKKGALALNLKLSVPQSDQVVISNFLTESGTFK 251 MKKG L L LKLSVPQ+DQV + FLTESGTFK Sbjct: 1 MKKGNLGLGLKLSVPQTDQVAFAKFLTESGTFK 33 >XP_009609827.1 PREDICTED: mitogen-activated protein kinase kinase 2-like [Nicotiana tomentosiformis] Length = 118 Score = 49.7 bits (117), Expect = 1e-05 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 153 MKKGALALNLKLSVPQSDQVVISNFLTESGTFK 251 MKKG+LA NLKLS+P D+V +S FLTESGTFK Sbjct: 1 MKKGSLAPNLKLSLPPPDEVNLSKFLTESGTFK 33