BLASTX nr result
ID: Lithospermum23_contig00021969
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00021969 (319 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019186364.1 PREDICTED: iron-sulfur assembly protein IscA-like... 90 1e-20 XP_015085142.1 PREDICTED: iron-sulfur assembly protein IscA-like... 90 1e-20 XP_006344753.1 PREDICTED: iron-sulfur assembly protein IscA-like... 90 1e-20 XP_004230302.1 PREDICTED: iron-sulfur assembly protein IscA-like... 90 1e-20 XP_009804604.1 PREDICTED: iron-sulfur assembly protein IscA-like... 89 3e-20 XP_009617972.1 PREDICTED: iron-sulfur assembly protein IscA-like... 89 4e-20 XP_009789312.1 PREDICTED: iron-sulfur assembly protein IscA-like... 89 4e-20 XP_019241161.1 PREDICTED: iron-sulfur assembly protein IscA-like... 89 4e-20 XP_019239774.1 PREDICTED: iron-sulfur assembly protein IscA-like... 88 5e-20 XP_016559866.1 PREDICTED: iron-sulfur assembly protein IscA-like... 88 5e-20 XP_016538774.1 PREDICTED: iron-sulfur assembly protein IscA-like... 88 6e-20 XP_012836112.1 PREDICTED: iron-sulfur assembly protein IscA-like... 88 7e-20 XP_019158656.1 PREDICTED: iron-sulfur assembly protein IscA-like... 88 8e-20 XP_009339407.2 PREDICTED: iron-sulfur assembly protein IscA-like... 86 9e-20 XP_002282626.1 PREDICTED: iron-sulfur assembly protein IscA-like... 87 1e-19 XP_011094337.1 PREDICTED: iron-sulfur assembly protein IscA-like... 86 3e-19 XP_006481777.1 PREDICTED: iron-sulfur assembly protein IscA-like... 86 4e-19 XP_006430202.1 hypothetical protein CICLE_v10012954mg [Citrus cl... 86 4e-19 XP_012066497.1 PREDICTED: iron-sulfur assembly protein IscA-like... 86 4e-19 XP_004152897.1 PREDICTED: iron-sulfur assembly protein IscA-like... 86 4e-19 >XP_019186364.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Ipomoea nil] Length = 160 Score = 90.1 bits (222), Expect = 1e-20 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVKQ 142 VD ISFDFV GATVDYVEELIRSAFQVS NPSAVGGCSCKSSFMVKQ Sbjct: 114 VDNISFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVKQ 160 >XP_015085142.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Solanum pennellii] Length = 160 Score = 89.7 bits (221), Expect = 1e-20 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVKQ 142 VD +SFDFV GATVDYVEELIRSAFQVS NPSAVGGCSCKSSFMVKQ Sbjct: 114 VDNVSFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVKQ 160 >XP_006344753.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Solanum tuberosum] Length = 160 Score = 89.7 bits (221), Expect = 1e-20 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVKQ 142 VD +SFDFV GATVDYVEELIRSAFQVS NPSAVGGCSCKSSFMVKQ Sbjct: 114 VDNVSFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVKQ 160 >XP_004230302.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Solanum lycopersicum] Length = 160 Score = 89.7 bits (221), Expect = 1e-20 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVKQ 142 VD +SFDFV GATVDYVEELIRSAFQVS NPSAVGGCSCKSSFMVKQ Sbjct: 114 VDNVSFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVKQ 160 >XP_009804604.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana sylvestris] XP_016503625.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana tabacum] Length = 153 Score = 88.6 bits (218), Expect = 3e-20 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVKQ 142 VD +S+DFV GATVDYVEELIRSAFQVS NPSAVGGCSCKSSFMVKQ Sbjct: 107 VDNVSYDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVKQ 153 >XP_009617972.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial isoform X1 [Nicotiana tomentosiformis] XP_016492065.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana tabacum] XP_018631140.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial isoform X1 [Nicotiana tomentosiformis] Length = 157 Score = 88.6 bits (218), Expect = 4e-20 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVKQ 142 VD +S+DFV GATVDYVEELIRSAFQVS NPSAVGGCSCKSSFMVKQ Sbjct: 111 VDNVSYDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVKQ 157 >XP_009789312.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana sylvestris] XP_016457278.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana tabacum] Length = 158 Score = 88.6 bits (218), Expect = 4e-20 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVKQ 142 VD +S+DFV GATVDYVEELIRSAFQVS NPSAVGGCSCKSSFMVKQ Sbjct: 112 VDNVSYDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVKQ 158 >XP_019241161.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana attenuata] XP_019242787.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana attenuata] OIT07612.1 iron-sulfur assembly protein isca-like 2, mitochondrial [Nicotiana attenuata] OIT19682.1 iron-sulfur assembly protein isca-like 2, mitochondrial [Nicotiana attenuata] Length = 161 Score = 88.6 bits (218), Expect = 4e-20 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVKQ 142 VD +S+DFV GATVDYVEELIRSAFQVS NPSAVGGCSCKSSFMVKQ Sbjct: 115 VDNVSYDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVKQ 161 >XP_019239774.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana attenuata] OIT20767.1 iron-sulfur assembly protein isca-like 2, mitochondrial [Nicotiana attenuata] Length = 158 Score = 88.2 bits (217), Expect = 5e-20 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVKQ 142 VD +S+DF+ GATVDYVEELIRSAFQVS NPSAVGGCSCKSSFMVKQ Sbjct: 112 VDNVSYDFIKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVKQ 158 >XP_016559866.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Capsicum annuum] Length = 158 Score = 88.2 bits (217), Expect = 5e-20 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVK 139 VD ISFDFV GATVDYVEELIRSAFQVS NPSAVGGCSCKSSFMVK Sbjct: 112 VDNISFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVK 157 >XP_016538774.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Capsicum annuum] Length = 160 Score = 88.2 bits (217), Expect = 6e-20 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVK 139 VD ISFDFV GATVDYVEELIRSAFQVS NPSAVGGCSCKSSFMVK Sbjct: 114 VDNISFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVK 159 >XP_012836112.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Erythranthe guttata] EYU38634.1 hypothetical protein MIMGU_mgv1a015468mg [Erythranthe guttata] Length = 157 Score = 87.8 bits (216), Expect = 7e-20 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVK 139 VD ISFDFV GAT+DYVEELIRSAFQVS NPSAVGGCSCKSSFMVK Sbjct: 112 VDNISFDFVKGATIDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVK 157 >XP_019158656.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Ipomoea nil] Length = 160 Score = 87.8 bits (216), Expect = 8e-20 Identities = 43/47 (91%), Positives = 43/47 (91%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVKQ 142 VD ISFDFV GATVDYVEELIRSAFQVS NPSAVGGC CKSSFMVKQ Sbjct: 114 VDNISFDFVKGATVDYVEELIRSAFQVSNNPSAVGGCGCKSSFMVKQ 160 >XP_009339407.2 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Pyrus x bretschneideri] Length = 97 Score = 85.9 bits (211), Expect = 9e-20 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVK 139 VD IS+DFV GATVDYVEELIRSAFQV+ NPSAVGGCSCKSSFMVK Sbjct: 52 VDNISYDFVKGATVDYVEELIRSAFQVTTNPSAVGGCSCKSSFMVK 97 >XP_002282626.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial isoform X2 [Vitis vinifera] CBI30295.3 unnamed protein product, partial [Vitis vinifera] Length = 154 Score = 87.0 bits (214), Expect = 1e-19 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVKQ 142 VDKIS+DFV GATVDYVEELIRSAF VS NPSAVGGCSCKSSFMVK+ Sbjct: 108 VDKISYDFVKGATVDYVEELIRSAFLVSTNPSAVGGCSCKSSFMVKE 154 >XP_011094337.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial isoform X1 [Sesamum indicum] Length = 157 Score = 86.3 bits (212), Expect = 3e-19 Identities = 41/46 (89%), Positives = 42/46 (91%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVK 139 VD +SFDFV GATVDYVEELIRSAFQVS NPSAVGGCSCKSSFM K Sbjct: 112 VDNVSFDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMAK 157 >XP_006481777.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Citrus sinensis] KDO70396.1 hypothetical protein CISIN_1g031188mg [Citrus sinensis] Length = 164 Score = 86.3 bits (212), Expect = 4e-19 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVKQ 142 VD IS+DFV GATVDYVEELIRSAF VS NPSAVGGCSCKSSFMVKQ Sbjct: 118 VDNISYDFVKGATVDYVEELIRSAFVVSTNPSAVGGCSCKSSFMVKQ 164 >XP_006430202.1 hypothetical protein CICLE_v10012954mg [Citrus clementina] ESR43442.1 hypothetical protein CICLE_v10012954mg [Citrus clementina] Length = 164 Score = 86.3 bits (212), Expect = 4e-19 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVKQ 142 VD IS+DFV GATVDYVEELIRSAF VS NPSAVGGCSCKSSFMVKQ Sbjct: 118 VDNISYDFVKGATVDYVEELIRSAFVVSTNPSAVGGCSCKSSFMVKQ 164 >XP_012066497.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Jatropha curcas] KDP42748.1 hypothetical protein JCGZ_23688 [Jatropha curcas] Length = 156 Score = 85.9 bits (211), Expect = 4e-19 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVKQ 142 VD IS+DFV GAT+DYVEELIRSAF V++NPSAVGGCSCKSSFMVKQ Sbjct: 110 VDNISYDFVKGATIDYVEELIRSAFVVTINPSAVGGCSCKSSFMVKQ 156 >XP_004152897.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Cucumis sativus] KGN65682.1 hypothetical protein Csa_1G496290 [Cucumis sativus] Length = 157 Score = 85.9 bits (211), Expect = 4e-19 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = +2 Query: 2 VDKISFDFVSGATVDYVEELIRSAFQVSLNPSAVGGCSCKSSFMVKQ 142 VD IS+DFV GAT+DYVEELIRSAF VS NPSAVGGCSCKSSFMVKQ Sbjct: 111 VDNISYDFVKGATIDYVEELIRSAFVVSTNPSAVGGCSCKSSFMVKQ 157