BLASTX nr result
ID: Lithospermum23_contig00021678
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00021678 (922 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019183264.1 PREDICTED: fimbrin-1-like [Ipomoea nil] XP_019183... 84 2e-21 XP_012849035.1 PREDICTED: fimbrin-1 [Erythranthe guttata] EYU273... 84 3e-21 XP_011095479.1 PREDICTED: fimbrin-1 [Sesamum indicum] 84 4e-21 XP_015082375.1 PREDICTED: fimbrin-1 [Solanum pennellii] XP_01508... 83 5e-21 XP_004244079.1 PREDICTED: fimbrin-1 [Solanum lycopersicum] XP_01... 83 5e-21 XP_016581368.1 PREDICTED: fimbrin-1 [Capsicum annuum] XP_0165813... 83 5e-21 XP_019226804.1 PREDICTED: fimbrin-1-like [Nicotiana attenuata] O... 83 5e-21 XP_009784171.1 PREDICTED: fimbrin-1-like isoform X1 [Nicotiana s... 83 5e-21 XP_016509377.1 PREDICTED: fimbrin-1-like [Nicotiana tabacum] 83 5e-21 XP_009784172.1 PREDICTED: fimbrin-1-like isoform X2 [Nicotiana s... 83 5e-21 XP_009591435.1 PREDICTED: fimbrin-1-like [Nicotiana tomentosifor... 83 5e-21 XP_015163663.1 PREDICTED: fimbrin-1-like [Solanum tuberosum] 83 5e-21 XP_017247892.1 PREDICTED: fimbrin-1-like [Daucus carota subsp. s... 85 5e-21 KZM99435.1 hypothetical protein DCAR_013203 [Daucus carota subsp... 85 5e-21 KVI10431.1 hypothetical protein Ccrd_011189 [Cynara cardunculus ... 84 5e-21 KDO58475.1 hypothetical protein CISIN_1g005777mg [Citrus sinensis] 82 1e-20 XP_006447706.1 hypothetical protein CICLE_v10014495mg [Citrus cl... 82 1e-20 KZV36203.1 fimbrin-1 [Dorcoceras hygrometricum] 82 1e-20 CDP13763.1 unnamed protein product [Coffea canephora] 84 4e-20 XP_002515869.1 PREDICTED: fimbrin-1 [Ricinus communis] XP_015572... 81 4e-20 >XP_019183264.1 PREDICTED: fimbrin-1-like [Ipomoea nil] XP_019183265.1 PREDICTED: fimbrin-1-like [Ipomoea nil] Length = 773 Score = 84.3 bits (207), Expect(2) = 2e-21 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNLRKTPQL+ELVEDNNDVEEL+GL PEK+ LKWMNFH Sbjct: 236 KIQLLADLNLRKTPQLVELVEDNNDVEELLGLAPEKVLLKWMNFH 280 Score = 47.4 bits (111), Expect(2) = 2e-21 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = +1 Query: 637 HLKRVLNPWERNENHTLCLTSAVA 708 ++KRVLNPWERNENHTLCL SA A Sbjct: 183 NVKRVLNPWERNENHTLCLNSAKA 206 >XP_012849035.1 PREDICTED: fimbrin-1 [Erythranthe guttata] EYU27399.1 hypothetical protein MIMGU_mgv1a001840mg [Erythranthe guttata] Length = 751 Score = 84.3 bits (207), Expect(2) = 3e-21 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLL+DLNLRKTPQLLELVEDNNDVEEL+GL PEK+ LKWMNFH Sbjct: 236 KIQLLSDLNLRKTPQLLELVEDNNDVEELMGLAPEKILLKWMNFH 280 Score = 46.6 bits (109), Expect(2) = 3e-21 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +1 Query: 643 KRVLNPWERNENHTLCLTSAVA 708 KRVLNPWERNENHTLCL SA A Sbjct: 185 KRVLNPWERNENHTLCLNSAKA 206 >XP_011095479.1 PREDICTED: fimbrin-1 [Sesamum indicum] Length = 763 Score = 84.0 bits (206), Expect(2) = 4e-21 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNLRKTP+LLELVEDNNDVEEL+GL PEK+ LKWMNFH Sbjct: 236 KIQLLADLNLRKTPELLELVEDNNDVEELMGLAPEKVLLKWMNFH 280 Score = 46.6 bits (109), Expect(2) = 4e-21 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +1 Query: 643 KRVLNPWERNENHTLCLTSAVA 708 KRVLNPWERNENHTLCL SA A Sbjct: 185 KRVLNPWERNENHTLCLNSAKA 206 >XP_015082375.1 PREDICTED: fimbrin-1 [Solanum pennellii] XP_015082376.1 PREDICTED: fimbrin-1 [Solanum pennellii] Length = 892 Score = 83.2 bits (204), Expect(2) = 5e-21 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNLRKTPQL+ELVED+NDVEEL+GL PEKL LKWMNFH Sbjct: 235 KIQLLADLNLRKTPQLVELVEDSNDVEELMGLAPEKLLLKWMNFH 279 Score = 47.0 bits (110), Expect(2) = 5e-21 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 637 HLKRVLNPWERNENHTLCLTSAVA 708 ++KRV+NPWERNENHTLCL SA A Sbjct: 182 NMKRVINPWERNENHTLCLNSAKA 205 >XP_004244079.1 PREDICTED: fimbrin-1 [Solanum lycopersicum] XP_010324295.1 PREDICTED: fimbrin-1 [Solanum lycopersicum] XP_010324296.1 PREDICTED: fimbrin-1 [Solanum lycopersicum] XP_010324297.1 PREDICTED: fimbrin-1 [Solanum lycopersicum] XP_010324298.1 PREDICTED: fimbrin-1 [Solanum lycopersicum] Length = 892 Score = 83.2 bits (204), Expect(2) = 5e-21 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNLRKTPQL+ELVED+NDVEEL+GL PEKL LKWMNFH Sbjct: 235 KIQLLADLNLRKTPQLVELVEDSNDVEELMGLAPEKLLLKWMNFH 279 Score = 47.0 bits (110), Expect(2) = 5e-21 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 637 HLKRVLNPWERNENHTLCLTSAVA 708 ++KRV+NPWERNENHTLCL SA A Sbjct: 182 NMKRVINPWERNENHTLCLNSAKA 205 >XP_016581368.1 PREDICTED: fimbrin-1 [Capsicum annuum] XP_016581369.1 PREDICTED: fimbrin-1 [Capsicum annuum] XP_016581370.1 PREDICTED: fimbrin-1 [Capsicum annuum] Length = 841 Score = 83.2 bits (204), Expect(2) = 5e-21 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNLRKTPQL+ELVED+NDVEEL+GL PEKL LKWMNFH Sbjct: 235 KIQLLADLNLRKTPQLVELVEDSNDVEELMGLAPEKLLLKWMNFH 279 Score = 47.0 bits (110), Expect(2) = 5e-21 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 637 HLKRVLNPWERNENHTLCLTSAVA 708 ++KRV+NPWERNENHTLCL SA A Sbjct: 182 NMKRVINPWERNENHTLCLNSAKA 205 >XP_019226804.1 PREDICTED: fimbrin-1-like [Nicotiana attenuata] OIT31819.1 fimbrin-1 [Nicotiana attenuata] Length = 816 Score = 83.2 bits (204), Expect(2) = 5e-21 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNLRKTPQL+ELVED+NDVEEL+GL PEKL LKWMNFH Sbjct: 235 KIQLLADLNLRKTPQLVELVEDSNDVEELMGLAPEKLLLKWMNFH 279 Score = 47.0 bits (110), Expect(2) = 5e-21 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 637 HLKRVLNPWERNENHTLCLTSAVA 708 ++KRV+NPWERNENHTLCL SA A Sbjct: 182 NMKRVINPWERNENHTLCLNSAKA 205 >XP_009784171.1 PREDICTED: fimbrin-1-like isoform X1 [Nicotiana sylvestris] XP_016499307.1 PREDICTED: fimbrin-1-like [Nicotiana tabacum] Length = 790 Score = 83.2 bits (204), Expect(2) = 5e-21 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNLRKTPQL+ELVED+NDVEEL+GL PEKL LKWMNFH Sbjct: 235 KIQLLADLNLRKTPQLVELVEDSNDVEELMGLAPEKLLLKWMNFH 279 Score = 47.0 bits (110), Expect(2) = 5e-21 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 637 HLKRVLNPWERNENHTLCLTSAVA 708 ++KRV+NPWERNENHTLCL SA A Sbjct: 182 NMKRVINPWERNENHTLCLNSAKA 205 >XP_016509377.1 PREDICTED: fimbrin-1-like [Nicotiana tabacum] Length = 782 Score = 83.2 bits (204), Expect(2) = 5e-21 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNLRKTPQL+ELVED+NDVEEL+GL PEKL LKWMNFH Sbjct: 235 KIQLLADLNLRKTPQLVELVEDSNDVEELMGLAPEKLLLKWMNFH 279 Score = 47.0 bits (110), Expect(2) = 5e-21 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 637 HLKRVLNPWERNENHTLCLTSAVA 708 ++KRV+NPWERNENHTLCL SA A Sbjct: 182 NMKRVINPWERNENHTLCLNSAKA 205 >XP_009784172.1 PREDICTED: fimbrin-1-like isoform X2 [Nicotiana sylvestris] Length = 777 Score = 83.2 bits (204), Expect(2) = 5e-21 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNLRKTPQL+ELVED+NDVEEL+GL PEKL LKWMNFH Sbjct: 235 KIQLLADLNLRKTPQLVELVEDSNDVEELMGLAPEKLLLKWMNFH 279 Score = 47.0 bits (110), Expect(2) = 5e-21 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 637 HLKRVLNPWERNENHTLCLTSAVA 708 ++KRV+NPWERNENHTLCL SA A Sbjct: 182 NMKRVINPWERNENHTLCLNSAKA 205 >XP_009591435.1 PREDICTED: fimbrin-1-like [Nicotiana tomentosiformis] Length = 777 Score = 83.2 bits (204), Expect(2) = 5e-21 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNLRKTPQL+ELVED+NDVEEL+GL PEKL LKWMNFH Sbjct: 235 KIQLLADLNLRKTPQLVELVEDSNDVEELMGLAPEKLLLKWMNFH 279 Score = 47.0 bits (110), Expect(2) = 5e-21 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 637 HLKRVLNPWERNENHTLCLTSAVA 708 ++KRV+NPWERNENHTLCL SA A Sbjct: 182 NMKRVINPWERNENHTLCLNSAKA 205 >XP_015163663.1 PREDICTED: fimbrin-1-like [Solanum tuberosum] Length = 746 Score = 83.2 bits (204), Expect(2) = 5e-21 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNLRKTPQL+ELVED+NDVEEL+GL PEKL LKWMNFH Sbjct: 235 KIQLLADLNLRKTPQLVELVEDSNDVEELMGLAPEKLLLKWMNFH 279 Score = 47.0 bits (110), Expect(2) = 5e-21 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 637 HLKRVLNPWERNENHTLCLTSAVA 708 ++KRV+NPWERNENHTLCL SA A Sbjct: 182 NMKRVINPWERNENHTLCLNSAKA 205 >XP_017247892.1 PREDICTED: fimbrin-1-like [Daucus carota subsp. sativus] XP_017247893.1 PREDICTED: fimbrin-1-like [Daucus carota subsp. sativus] Length = 738 Score = 84.7 bits (208), Expect(2) = 5e-21 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNLRKTPQLLELVE+NND+EELIGL PEK+ LKWMNFH Sbjct: 234 KIQLLADLNLRKTPQLLELVEENNDIEELIGLPPEKVLLKWMNFH 278 Score = 45.4 bits (106), Expect(2) = 5e-21 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +1 Query: 643 KRVLNPWERNENHTLCLTSAVA 708 K+VLNPWERNENHTLCL SA A Sbjct: 183 KKVLNPWERNENHTLCLNSAKA 204 >KZM99435.1 hypothetical protein DCAR_013203 [Daucus carota subsp. sativus] Length = 713 Score = 84.7 bits (208), Expect(2) = 5e-21 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNLRKTPQLLELVE+NND+EELIGL PEK+ LKWMNFH Sbjct: 234 KIQLLADLNLRKTPQLLELVEENNDIEELIGLPPEKVLLKWMNFH 278 Score = 45.4 bits (106), Expect(2) = 5e-21 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +1 Query: 643 KRVLNPWERNENHTLCLTSAVA 708 K+VLNPWERNENHTLCL SA A Sbjct: 183 KKVLNPWERNENHTLCLNSAKA 204 >KVI10431.1 hypothetical protein Ccrd_011189 [Cynara cardunculus var. scolymus] Length = 577 Score = 83.6 bits (205), Expect(2) = 5e-21 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 +IQLLADLNLRKTPQL+ELVEDNNDVEEL+GL PEK+ LKWMNFH Sbjct: 166 RIQLLADLNLRKTPQLVELVEDNNDVEELLGLAPEKILLKWMNFH 210 Score = 46.6 bits (109), Expect(2) = 5e-21 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +1 Query: 643 KRVLNPWERNENHTLCLTSAVA 708 KRVLNPWERNENHTLCL SA A Sbjct: 128 KRVLNPWERNENHTLCLNSAKA 149 >KDO58475.1 hypothetical protein CISIN_1g005777mg [Citrus sinensis] Length = 677 Score = 82.4 bits (202), Expect(2) = 1e-20 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNL+KTPQL+ELV+DNNDVEEL+GL PEK+ LKWMNFH Sbjct: 236 KIQLLADLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFH 280 Score = 46.6 bits (109), Expect(2) = 1e-20 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +1 Query: 643 KRVLNPWERNENHTLCLTSAVA 708 KRVLNPWERNENHTLCL SA A Sbjct: 185 KRVLNPWERNENHTLCLNSAKA 206 >XP_006447706.1 hypothetical protein CICLE_v10014495mg [Citrus clementina] XP_015383012.1 PREDICTED: fimbrin-5 [Citrus sinensis] ESR60946.1 hypothetical protein CICLE_v10014495mg [Citrus clementina] Length = 677 Score = 82.4 bits (202), Expect(2) = 1e-20 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNL+KTPQL+ELV+DNNDVEEL+GL PEK+ LKWMNFH Sbjct: 236 KIQLLADLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFH 280 Score = 46.6 bits (109), Expect(2) = 1e-20 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +1 Query: 643 KRVLNPWERNENHTLCLTSAVA 708 KRVLNPWERNENHTLCL SA A Sbjct: 185 KRVLNPWERNENHTLCLNSAKA 206 >KZV36203.1 fimbrin-1 [Dorcoceras hygrometricum] Length = 746 Score = 82.0 bits (201), Expect(2) = 1e-20 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNLRKTPQL+ELVED+NDVEEL+GL PEK+ LKWMNFH Sbjct: 236 KIQLLADLNLRKTPQLVELVEDSNDVEELMGLAPEKVLLKWMNFH 280 Score = 46.6 bits (109), Expect(2) = 1e-20 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +1 Query: 643 KRVLNPWERNENHTLCLTSAVA 708 KRVLNPWERNENHTLCL SA A Sbjct: 185 KRVLNPWERNENHTLCLNSAKA 206 >CDP13763.1 unnamed protein product [Coffea canephora] Length = 730 Score = 84.0 bits (206), Expect(2) = 4e-20 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADLNLRKTPQL+ELVEDNNDVEEL+GL PEK+ LKWMNFH Sbjct: 236 KIQLLADLNLRKTPQLVELVEDNNDVEELMGLAPEKVLLKWMNFH 280 Score = 43.1 bits (100), Expect(2) = 4e-20 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = +1 Query: 637 HLKRVLNPWERNENHTLCLTSAVA 708 ++KRVLNPWERNENHTL L SA A Sbjct: 183 NMKRVLNPWERNENHTLGLNSAKA 206 >XP_002515869.1 PREDICTED: fimbrin-1 [Ricinus communis] XP_015572774.1 PREDICTED: fimbrin-1 [Ricinus communis] EEF46538.1 fimbrin, putative [Ricinus communis] Length = 693 Score = 80.9 bits (198), Expect(2) = 4e-20 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +2 Query: 788 KIQLLADLNLRKTPQLLELVEDNNDVEELIGLDPEKL*LKWMNFH 922 KIQLLADL+L+KTPQL+ELV+DNNDVEEL+GL PEKL LKWMNFH Sbjct: 236 KIQLLADLSLKKTPQLVELVDDNNDVEELMGLAPEKLLLKWMNFH 280 Score = 46.2 bits (108), Expect(2) = 4e-20 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +1 Query: 643 KRVLNPWERNENHTLCLTSAVA 708 KR+LNPWERNENHTLCL SA A Sbjct: 185 KRILNPWERNENHTLCLNSAKA 206