BLASTX nr result
ID: Lithospermum23_contig00021290
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00021290 (266 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAO47202.1 hypothetical protein G7K_1412-t1 [Saitoella complicat... 115 3e-30 KZP03156.1 hypothetical protein FIBSPDRAFT_505248, partial [Fibu... 90 3e-22 WP_029467737.1 hypothetical protein [Hungatella hathewayi] 85 3e-19 AQP33833.1 hypothetical protein PN49_13035 [Vibrio anguillarum] 80 5e-18 KNA06142.1 hypothetical protein SOVF_183600 [Spinacia oleracea] 74 1e-15 OCK86501.1 hypothetical protein K441DRAFT_93587 [Cenococcum geop... 71 1e-14 OCL10867.1 hypothetical protein AOQ84DRAFT_396602 [Glonium stell... 67 4e-13 OJJ66804.1 hypothetical protein ASPBRDRAFT_366689 [Aspergillus b... 67 7e-13 CQB88528.1 Uncharacterised protein [Chlamydia trachomatis] 64 3e-12 XP_018060498.1 hypothetical protein LY89DRAFT_703091 [Phialoceph... 66 3e-12 OJJ41968.1 hypothetical protein ASPZODRAFT_1284245 [Penicilliops... 65 4e-12 XP_013946733.1 hypothetical protein TRIATDRAFT_255346 [Trichoder... 65 4e-12 OCH94923.1 hypothetical protein OBBRIDRAFT_705583, partial [Obba... 62 6e-11 KIJ93785.1 hypothetical protein K443DRAFT_377952, partial [Lacca... 63 6e-11 XP_007371709.1 hypothetical protein DICSQDRAFT_73523, partial [D... 62 7e-11 KII82787.1 hypothetical protein PLICRDRAFT_58628 [Plicaturopsis ... 61 1e-10 KIK49844.1 hypothetical protein GYMLUDRAFT_183501, partial [Gymn... 62 1e-10 KDQ49122.1 hypothetical protein JAAARDRAFT_143838, partial [Jaap... 61 1e-10 ODV97872.1 hypothetical protein PACTADRAFT_371 [Pachysolen tanno... 43 2e-09 EGN91453.1 hypothetical protein SERLA73DRAFT_67379, partial [Ser... 57 7e-09 >GAO47202.1 hypothetical protein G7K_1412-t1 [Saitoella complicata NRRL Y-17804] Length = 214 Score = 115 bits (287), Expect = 3e-30 Identities = 58/84 (69%), Positives = 61/84 (72%) Frame = -2 Query: 265 PPTIPINHYGGPRNQQNRTARPILLFHANVFEQRPALNTLIFSK*KSWFPDTPSEGHEVP 86 PPTIPINHYGGPRNQQNRT RPILLFHANVFEQ PALNTLIFS Sbjct: 78 PPTIPINHYGGPRNQQNRTTRPILLFHANVFEQMPALNTLIFSN---------------- 121 Query: 85 QKERPGRTSTRGEADRPARPKVQL 14 QKERPGR S+ EADRP RPK++L Sbjct: 122 QKERPGRVSSHREADRPTRPKLEL 145 >KZP03156.1 hypothetical protein FIBSPDRAFT_505248, partial [Fibulorhizoctonia sp. CBS 109695] Length = 50 Score = 90.1 bits (222), Expect = 3e-22 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = +3 Query: 93 SCPSLGVSGNQDFYFEKIRVFKAGLCSNTLAWNNRIGRAVLFCWF 227 +CP LG SGNQDFY EKIRVFKAGLC NTLAWNN IGRAVLFCWF Sbjct: 2 ACPLLGASGNQDFYLEKIRVFKAGLCPNTLAWNNEIGRAVLFCWF 46 >WP_029467737.1 hypothetical protein [Hungatella hathewayi] Length = 130 Score = 84.7 bits (208), Expect = 3e-19 Identities = 44/78 (56%), Positives = 48/78 (61%) Frame = -2 Query: 265 PPTIPINHYGGPRNQQNRTARPILLFHANVFEQRPALNTLIFSK*KSWFPDTPSEGHEVP 86 PPT+PINHY GPRNQQNRT RPILLFHAN+FEQ F K K P +G Sbjct: 2 PPTVPINHYDGPRNQQNRTKRPILLFHANIFEQYACFEHSNFFKVKVLVHQGP-QGPRAS 60 Query: 85 QKERPGRTSTRGEADRPA 32 QKERPGR + E PA Sbjct: 61 QKERPGRKNQYAEKSGPA 78 Score = 59.7 bits (143), Expect = 2e-09 Identities = 32/54 (59%), Positives = 34/54 (62%) Frame = -1 Query: 164 ACFEHSNFFKVKVLVPRHAQ*RA*GSPEGKARPDQYTR*GGPASQAQGSTTSFL 3 ACFEHSNFFKVKVLV + Q E R +QY GPA QAQ STTSFL Sbjct: 36 ACFEHSNFFKVKVLVHQGPQGPRASQKERPGRKNQYAEKSGPADQAQSSTTSFL 89 >AQP33833.1 hypothetical protein PN49_13035 [Vibrio anguillarum] Length = 89 Score = 80.5 bits (197), Expect = 5e-18 Identities = 45/82 (54%), Positives = 51/82 (62%), Gaps = 1/82 (1%) Frame = -2 Query: 265 PPTIPINHYGGPRNQQNRTARPILLFHANVFEQRPALNTLIFSK*KSWFPDTPSEGHEVP 86 PPT+PINHY GPRNQQNRT RPILLFHAN+FEQ F K K P +G +V Sbjct: 2 PPTVPINHYDGPRNQQNRTKRPILLFHANIFEQYACFEHSNFFKVKVLVRQEP-QGLKVS 60 Query: 85 QKERP-GRTSTRGEADRPARPK 23 QKERP ++STR PK Sbjct: 61 QKERPRWKSSTRKNRTGQPGPK 82 >KNA06142.1 hypothetical protein SOVF_183600 [Spinacia oleracea] Length = 59 Score = 73.6 bits (179), Expect = 1e-15 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 MRFPRRKGPAGPVHAVRRTGQPGPRFNYELFN 1 MRFPRRKGPAGPVHAVRRTGQPGPRFNYELFN Sbjct: 1 MRFPRRKGPAGPVHAVRRTGQPGPRFNYELFN 32 >OCK86501.1 hypothetical protein K441DRAFT_93587 [Cenococcum geophilum 1.58] Length = 59 Score = 71.2 bits (173), Expect = 1e-14 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 96 MRFPRRKGPAGPVHAVRRTGQPGPRFNYELFN 1 MR PRRKGPAGPVHAVRRTGQPGPRFNYELFN Sbjct: 1 MRLPRRKGPAGPVHAVRRTGQPGPRFNYELFN 32 >OCL10867.1 hypothetical protein AOQ84DRAFT_396602 [Glonium stellatum] Length = 68 Score = 67.4 bits (163), Expect = 4e-13 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -2 Query: 265 PPTIPINHYGGPRNQQNRTARPILLFHAN 179 PPTIPINHYGGPRNQQNRTARPILLFHAN Sbjct: 2 PPTIPINHYGGPRNQQNRTARPILLFHAN 30 >OJJ66804.1 hypothetical protein ASPBRDRAFT_366689 [Aspergillus brasiliensis CBS 101740] Length = 59 Score = 66.6 bits (161), Expect = 7e-13 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 96 MRFPRRKGPAGPVHAVRRTGQPGPRFNYELFN 1 MRFPRRKGPAGPV AVRRTGQP PRFNYELFN Sbjct: 1 MRFPRRKGPAGPVLAVRRTGQPDPRFNYELFN 32 >CQB88528.1 Uncharacterised protein [Chlamydia trachomatis] Length = 67 Score = 63.5 bits (153), Expect(2) = 3e-12 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +3 Query: 120 NQDFYFEKIRVFKAGLCSNTLAWNNRIGR 206 NQDFYFEKIRVFKAGLCSN LAWNNRIGR Sbjct: 3 NQDFYFEKIRVFKAGLCSNILAWNNRIGR 31 Score = 35.4 bits (80), Expect(2) = 3e-12 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 209 GSILLVSRTAVMINRDSRG 265 GSILLVSRT VMINRD RG Sbjct: 33 GSILLVSRTIVMINRDGRG 51 >XP_018060498.1 hypothetical protein LY89DRAFT_703091 [Phialocephala scopiformis] KUJ06143.1 hypothetical protein LY89DRAFT_703091 [Phialocephala scopiformis] Length = 90 Score = 65.9 bits (159), Expect = 3e-12 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 265 PPTIPINHYGGPRNQQNRTARPILLFHAN 179 PPTIPINHYGGPRNQQNRT RPILLFHAN Sbjct: 24 PPTIPINHYGGPRNQQNRTTRPILLFHAN 52 >OJJ41968.1 hypothetical protein ASPZODRAFT_1284245 [Penicilliopsis zonata CBS 506.65] Length = 59 Score = 64.7 bits (156), Expect = 4e-12 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -3 Query: 96 MRFPRRKGPAGPVHAVRRTGQPGPRFNYELFN 1 M FPRRKGPAGPV AVRRTGQP PRFNYELFN Sbjct: 1 MEFPRRKGPAGPVLAVRRTGQPDPRFNYELFN 32 >XP_013946733.1 hypothetical protein TRIATDRAFT_255346 [Trichoderma atroviride IMI 206040] EHK48568.1 hypothetical protein TRIATDRAFT_255346 [Trichoderma atroviride IMI 206040] Length = 59 Score = 64.7 bits (156), Expect = 4e-12 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -3 Query: 96 MRFPRRKGPAGPVHAVRRTGQPGPRFNYELFN 1 M F R KGPAGPVHAVRRTGQPGPRFNYELFN Sbjct: 1 MGFRRGKGPAGPVHAVRRTGQPGPRFNYELFN 32 >OCH94923.1 hypothetical protein OBBRIDRAFT_705583, partial [Obba rivulosa] Length = 57 Score = 61.6 bits (148), Expect = 6e-11 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 265 PPTIPINHYGGPRNQQNRTARPILLFHAN 179 PPTIPINHYG RNQQNRTARPILLFHAN Sbjct: 4 PPTIPINHYGDSRNQQNRTARPILLFHAN 32 >KIJ93785.1 hypothetical protein K443DRAFT_377952, partial [Laccaria amethystina LaAM-08-1] Length = 117 Score = 63.2 bits (152), Expect = 6e-11 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 117 GNQDFYFEKIRVFKAGLCSNTLAWNNRIGRAV 212 GNQDFY EKIRVFKAG+C NTLAWNN+IGR V Sbjct: 72 GNQDFYLEKIRVFKAGICPNTLAWNNKIGRIV 103 >XP_007371709.1 hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] EJF55554.1 hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] Length = 66 Score = 61.6 bits (148), Expect = 7e-11 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 265 PPTIPINHYGGPRNQQNRTARPILLFHAN 179 PPTIPINHYG RNQQNRTARPILLFHAN Sbjct: 4 PPTIPINHYGDSRNQQNRTARPILLFHAN 32 >KII82787.1 hypothetical protein PLICRDRAFT_58628 [Plicaturopsis crispa FD-325 SS-3] Length = 64 Score = 61.2 bits (147), Expect = 1e-10 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 265 PPTIPINHYGGPRNQQNRTARPILLFHAN 179 PPT+PINHYG RNQQNRTARPILLFHAN Sbjct: 2 PPTVPINHYGDSRNQQNRTARPILLFHAN 30 >KIK49844.1 hypothetical protein GYMLUDRAFT_183501, partial [Gymnopus luxurians FD-317 M1] Length = 79 Score = 61.6 bits (148), Expect = 1e-10 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 265 PPTIPINHYGGPRNQQNRTARPILLFHAN 179 PPTIPINHYG RNQQNRTARPILLFHAN Sbjct: 17 PPTIPINHYGDSRNQQNRTARPILLFHAN 45 >KDQ49122.1 hypothetical protein JAAARDRAFT_143838, partial [Jaapia argillacea MUCL 33604] Length = 80 Score = 61.2 bits (147), Expect = 1e-10 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 265 PPTIPINHYGGPRNQQNRTARPILLFHAN 179 PPT+PINHYG RNQQNRTARPILLFHAN Sbjct: 18 PPTVPINHYGDSRNQQNRTARPILLFHAN 46 >ODV97872.1 hypothetical protein PACTADRAFT_371 [Pachysolen tannophilus NRRL Y-2460] Length = 157 Score = 42.7 bits (99), Expect(3) = 2e-09 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +3 Query: 144 IRVFKAGLCSNTLAWNNRIGR 206 + VFKAGLCSN LAWNNRIGR Sbjct: 101 LAVFKAGLCSNILAWNNRIGR 121 Score = 35.4 bits (80), Expect(3) = 2e-09 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 209 GSILLVSRTAVMINRDSRG 265 GSILLVSRT VMINRD RG Sbjct: 123 GSILLVSRTIVMINRDGRG 141 Score = 30.0 bits (66), Expect(3) = 2e-09 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 1 VKKLVVEPWAWLA 39 VKKLVVEPW WLA Sbjct: 90 VKKLVVEPWDWLA 102 >EGN91453.1 hypothetical protein SERLA73DRAFT_67379, partial [Serpula lacrymans var. lacrymans S7.3] Length = 80 Score = 57.0 bits (136), Expect = 7e-09 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -2 Query: 262 PTIPINHYGGPRNQQNRTARPILLFHAN 179 PT+PINHYG RNQQNRTA PILLFHAN Sbjct: 19 PTVPINHYGNSRNQQNRTAHPILLFHAN 46