BLASTX nr result
ID: Lithospermum23_contig00021170
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00021170 (484 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009338467.1 hypothetical protein RF2 (chloroplast) [Pterygopl... 59 3e-07 ANS72073.1 Ycf2 (chloroplast) [Glehnia littoralis] 59 3e-07 KZM81267.1 hypothetical protein DCAR_032529 (plastid) [Daucus ca... 59 3e-07 YP_740161.1 hypothetical protein RF2 (chloroplast) [Daucus carot... 59 3e-07 ADK89907.1 hypothetical chloroplast RF21 (chloroplast) [Crithmum... 59 3e-07 YP_009236008.1 hypothetical chloroplast RF2 (chloroplast) [Aneth... 59 3e-07 YP_009232958.1 Ycf2 (chloroplast) [Angelica gigas] AMA98040.1 Yc... 59 3e-07 YP_009233043.1 Ycf2 (chloroplast) [Ligusticum tenuissimum] YP_00... 59 3e-07 YP_009232788.1 Ycf2 (chloroplast) [Angelica acutiloba] AMA97869.... 59 3e-07 YP_009155256.1 Ycf2 (plastid) [Pastinaca pimpinellifolia] AIU990... 59 3e-07 YP_004222690.1 hypothetical chloroplast RF21 (chloroplast) [Anth... 59 3e-07 ALN96882.1 Ycf2 (chloroplast) [Angelica decursiva] 59 3e-07 YP_009243609.1 hypothetical chloroplast RF2 (chloroplast) [Coria... 59 3e-07 YP_009232873.1 Ycf2 (chloroplast) [Angelica dahurica] AMA97955.1... 59 3e-07 ADK89822.1 hypothetical chloroplast RF21 (chloroplast) [Tiedeman... 59 3e-07 YP_009186296.1 Ycf2 (chloroplast) [Ostericum grosseserratum] ALO... 59 3e-07 YP_005089456.1 ycf2 gene product (chloroplast) [Silene noctiflor... 59 5e-07 YP_009132980.1 Ycf2 (chloroplast) [Hibiscus syriacus] AJC09100.1... 59 5e-07 ALM55485.1 ycf2, partial (chloroplast) [Trillium catesbaei] 58 6e-07 AEK71487.1 hypothetical chloroplast RF2 (plastid) [Ixerba brexio... 58 7e-07 >YP_009338467.1 hypothetical protein RF2 (chloroplast) [Pterygopleurum neurophyllum] YP_009338484.1 hypothetical protein RF2 (chloroplast) [Pterygopleurum neurophyllum] ANK36562.1 hypothetical protein RF2 (chloroplast) [Pterygopleurum neurophyllum] ANK36579.1 hypothetical protein RF2 (chloroplast) [Pterygopleurum neurophyllum] Length = 2077 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 305 SIKTRFYITLQFELAKAMSSCIIWIPNIHDM 213 S K RFYITLQFELAKAMS CIIWIPNIHD+ Sbjct: 1496 SEKDRFYITLQFELAKAMSPCIIWIPNIHDL 1526 >ANS72073.1 Ycf2 (chloroplast) [Glehnia littoralis] Length = 2091 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 305 SIKTRFYITLQFELAKAMSSCIIWIPNIHDM 213 S K RFYITLQFELAKAMS CIIWIPNIHD+ Sbjct: 1521 SEKDRFYITLQFELAKAMSPCIIWIPNIHDL 1551 >KZM81267.1 hypothetical protein DCAR_032529 (plastid) [Daucus carota subsp. sativus] KZM81284.1 hypothetical protein DCAR_032547 (plastid) [Daucus carota subsp. sativus] Length = 2091 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 305 SIKTRFYITLQFELAKAMSSCIIWIPNIHDM 213 S K RFYITLQFELAKAMS CIIWIPNIHD+ Sbjct: 1510 SEKDRFYITLQFELAKAMSPCIIWIPNIHDL 1540 >YP_740161.1 hypothetical protein RF2 (chloroplast) [Daucus carota] YP_740178.1 hypothetical protein RF2 (chloroplast) [Daucus carota] Q0G9Q1.1 RecName: Full=Protein Ycf2 ABI32467.1 hypothetical protein RF2 (chloroplast) [Daucus carota] ABI32486.1 hypothetical protein RF2 (chloroplast) [Daucus carota] Length = 2091 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 305 SIKTRFYITLQFELAKAMSSCIIWIPNIHDM 213 S K RFYITLQFELAKAMS CIIWIPNIHD+ Sbjct: 1510 SEKDRFYITLQFELAKAMSPCIIWIPNIHDL 1540 >ADK89907.1 hypothetical chloroplast RF21 (chloroplast) [Crithmum maritimum] ADK89925.1 hypothetical chloroplast RF21 (chloroplast) [Crithmum maritimum] Length = 2092 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 305 SIKTRFYITLQFELAKAMSSCIIWIPNIHDM 213 S K RFYITLQFELAKAMS CIIWIPNIHD+ Sbjct: 1521 SEKDRFYITLQFELAKAMSPCIIWIPNIHDL 1551 >YP_009236008.1 hypothetical chloroplast RF2 (chloroplast) [Anethum graveolens] YP_009236025.1 hypothetical chloroplast RF2 (chloroplast) [Anethum graveolens] ABU85175.1 hypothetical protein RF2, partial (chloroplast) [Anethum graveolens] AMD84044.1 hypothetical chloroplast RF2 (chloroplast) [Anethum graveolens] AMD84062.1 hypothetical chloroplast RF2 (chloroplast) [Anethum graveolens] Length = 2092 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 305 SIKTRFYITLQFELAKAMSSCIIWIPNIHDM 213 S K RFYITLQFELAKAMS CIIWIPNIHD+ Sbjct: 1521 SEKDRFYITLQFELAKAMSPCIIWIPNIHDL 1551 >YP_009232958.1 Ycf2 (chloroplast) [Angelica gigas] AMA98040.1 Ycf2 (chloroplast) [Angelica gigas] Length = 2098 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 305 SIKTRFYITLQFELAKAMSSCIIWIPNIHDM 213 S K RFYITLQFELAKAMS CIIWIPNIHD+ Sbjct: 1527 SEKDRFYITLQFELAKAMSPCIIWIPNIHDL 1557 >YP_009233043.1 Ycf2 (chloroplast) [Ligusticum tenuissimum] YP_009233062.1 Ycf2 (chloroplast) [Ligusticum tenuissimum] AMA98127.1 Ycf2 (chloroplast) [Ligusticum tenuissimum] AMA98128.1 Ycf2 (chloroplast) [Ligusticum tenuissimum] Length = 2100 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 305 SIKTRFYITLQFELAKAMSSCIIWIPNIHDM 213 S K RFYITLQFELAKAMS CIIWIPNIHD+ Sbjct: 1529 SEKDRFYITLQFELAKAMSPCIIWIPNIHDL 1559 >YP_009232788.1 Ycf2 (chloroplast) [Angelica acutiloba] AMA97869.1 Ycf2 (chloroplast) [Angelica acutiloba] Length = 2100 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 305 SIKTRFYITLQFELAKAMSSCIIWIPNIHDM 213 S K RFYITLQFELAKAMS CIIWIPNIHD+ Sbjct: 1526 SEKDRFYITLQFELAKAMSPCIIWIPNIHDL 1556 >YP_009155256.1 Ycf2 (plastid) [Pastinaca pimpinellifolia] AIU99065.1 Ycf2 (plastid) [Pastinaca pimpinellifolia] Length = 2101 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 305 SIKTRFYITLQFELAKAMSSCIIWIPNIHDM 213 S K RFYITLQFELAKAMS CIIWIPNIHD+ Sbjct: 1530 SEKDRFYITLQFELAKAMSPCIIWIPNIHDL 1560 >YP_004222690.1 hypothetical chloroplast RF21 (chloroplast) [Anthriscus cerefolium] YP_004222707.1 hypothetical chloroplast RF21 (chloroplast) [Anthriscus cerefolium] ADD13682.1 hypothetical chloroplast RF21 (chloroplast) [Anthriscus cerefolium] ADD13700.1 hypothetical chloroplast RF21 (chloroplast) [Anthriscus cerefolium] Length = 2102 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 305 SIKTRFYITLQFELAKAMSSCIIWIPNIHDM 213 S K RFYITLQFELAKAMS CIIWIPNIHD+ Sbjct: 1521 SEKDRFYITLQFELAKAMSPCIIWIPNIHDL 1551 >ALN96882.1 Ycf2 (chloroplast) [Angelica decursiva] Length = 2104 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 305 SIKTRFYITLQFELAKAMSSCIIWIPNIHDM 213 S K RFYITLQFELAKAMS CIIWIPNIHD+ Sbjct: 1533 SEKDRFYITLQFELAKAMSPCIIWIPNIHDL 1563 >YP_009243609.1 hypothetical chloroplast RF2 (chloroplast) [Coriandrum sativum] AKS03660.1 hypothetical chloroplast RF2 (chloroplast) [Coriandrum sativum] Length = 2109 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 305 SIKTRFYITLQFELAKAMSSCIIWIPNIHDM 213 S K RFYITLQFELAKAMS CIIWIPNIHD+ Sbjct: 1538 SEKDRFYITLQFELAKAMSPCIIWIPNIHDL 1568 >YP_009232873.1 Ycf2 (chloroplast) [Angelica dahurica] AMA97955.1 Ycf2 (chloroplast) [Angelica dahurica] Length = 2110 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 305 SIKTRFYITLQFELAKAMSSCIIWIPNIHDM 213 S K RFYITLQFELAKAMS CIIWIPNIHD+ Sbjct: 1539 SEKDRFYITLQFELAKAMSPCIIWIPNIHDL 1569 >ADK89822.1 hypothetical chloroplast RF21 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] ADK89840.1 hypothetical chloroplast RF21 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] Length = 2111 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 305 SIKTRFYITLQFELAKAMSSCIIWIPNIHDM 213 S K RFYITLQFELAKAMS CIIWIPNIHD+ Sbjct: 1530 SEKDRFYITLQFELAKAMSPCIIWIPNIHDL 1560 >YP_009186296.1 Ycf2 (chloroplast) [Ostericum grosseserratum] ALO71659.1 Ycf2 (chloroplast) [Ostericum grosseserratum] Length = 2114 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 305 SIKTRFYITLQFELAKAMSSCIIWIPNIHDM 213 S K RFYITLQFELAKAMS CIIWIPNIHD+ Sbjct: 1543 SEKDRFYITLQFELAKAMSPCIIWIPNIHDL 1573 >YP_005089456.1 ycf2 gene product (chloroplast) [Silene noctiflora] YP_005089475.1 ycf2 gene product (chloroplast) [Silene noctiflora] AEC04207.1 hypothetical chloroplast RF21 (chloroplast) [Silene noctiflora] AEC04226.1 hypothetical chloroplast RF21 (chloroplast) [Silene noctiflora] Length = 2152 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/55 (52%), Positives = 39/55 (70%) Frame = -3 Query: 302 IKTRFYITLQFELAKAMSSCIIWIPNIHDMV*VKDIDGLYMTMCIIPPKNENEVW 138 + T+FYITLQFELAKAMS CI+WIPNIHD+ VK+ + L + + + + E W Sbjct: 1604 LPTQFYITLQFELAKAMSPCIMWIPNIHDLA-VKESNYLSLGLLVNYLSRDCERW 1657 >YP_009132980.1 Ycf2 (chloroplast) [Hibiscus syriacus] AJC09100.1 Ycf2 (chloroplast) [Hibiscus syriacus] AJC09117.1 Ycf2 (chloroplast) [Hibiscus syriacus] AKA94901.1 Ycf2 (chloroplast) [Hibiscus syriacus] ALI86880.1 hypothetical chloroplast RF2 (chloroplast) [Hibiscus syriacus] ALI86897.1 hypothetical chloroplast RF2 (chloroplast) [Hibiscus syriacus] Length = 2293 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -3 Query: 293 RFYITLQFELAKAMSSCIIWIPNIHDMV*VKDIDGLYMTMCI 168 RFYITLQFELAKAMS CIIWIPNIHD+ V + + LY+ + + Sbjct: 1723 RFYITLQFELAKAMSPCIIWIPNIHDLD-VNEANYLYLGLLV 1763 >ALM55485.1 ycf2, partial (chloroplast) [Trillium catesbaei] Length = 306 Score = 57.8 bits (138), Expect = 6e-07 Identities = 28/59 (47%), Positives = 39/59 (66%) Frame = -3 Query: 341 TIIQYIHLNSDSSIKTRFYITLQFELAKAMSSCIIWIPNIHDMV*VKDIDGLYMTMCII 165 T+ + + I RFYITLQFEL KA+S CIIWIPNIHD+ V D + Y+++ ++ Sbjct: 107 TMTNVLPMYMTPKIDDRFYITLQFELVKAISPCIIWIPNIHDLY-VNDSNSNYLSLGLL 164 >AEK71487.1 hypothetical chloroplast RF2 (plastid) [Ixerba brexioides] Length = 2278 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -3 Query: 293 RFYITLQFELAKAMSSCIIWIPNIHDMV*VKDIDGLYMTMCI 168 RFYITLQFELAKAMS CIIWIPNIHD+ V + + LY+ + + Sbjct: 1715 RFYITLQFELAKAMSPCIIWIPNIHDLD-VNESNYLYLGLLV 1755