BLASTX nr result
ID: Lithospermum23_contig00020781
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00020781 (223 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP20466.1 unnamed protein product [Coffea canephora] 63 1e-11 KVH94187.1 hypothetical protein Ccrd_003760 [Cynara cardunculus ... 61 7e-11 XP_012846375.1 PREDICTED: methionine--tRNA ligase, mitochondrial... 65 2e-10 KVI08344.1 hypothetical protein Ccrd_013300 [Cynara cardunculus ... 57 4e-09 KJB22935.1 hypothetical protein B456_004G074800 [Gossypium raimo... 51 2e-06 XP_007161701.1 hypothetical protein PHAVU_001G090900g [Phaseolus... 50 2e-06 XP_013453607.1 hypothetical protein MTR_5g024973 [Medicago trunc... 50 4e-06 ONK76750.1 uncharacterized protein A4U43_C03F31720 [Asparagus of... 50 6e-06 >CDP20466.1 unnamed protein product [Coffea canephora] Length = 63 Score = 62.8 bits (151), Expect = 1e-11 Identities = 35/50 (70%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +1 Query: 76 NDHLLQRGL-NQTPSATNHALVPWS*FIHQTWFLVSLELKDTEVRAYRTD 222 ND LL L ++ A NHALV S FIHQTWF VSLELKDTEVRAYRTD Sbjct: 8 NDPLLSWQLGSRATRAVNHALVKRSYFIHQTWFPVSLELKDTEVRAYRTD 57 >KVH94187.1 hypothetical protein Ccrd_003760 [Cynara cardunculus var. scolymus] Length = 73 Score = 61.2 bits (147), Expect = 7e-11 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = +1 Query: 76 NDHLLQRGLNQTPSATNHALVPWS*FIHQTWFLVSLELKDTEVRAYRTD 222 NDHL GL + + NHALV WS FI+QTW V L +K+TEVRAYRTD Sbjct: 10 NDHLPSHGLPRPWVSVNHALVTWSWFINQTWVSVFLGIKNTEVRAYRTD 58 >XP_012846375.1 PREDICTED: methionine--tRNA ligase, mitochondrial, partial [Erythranthe guttata] Length = 817 Score = 64.7 bits (156), Expect = 2e-10 Identities = 39/68 (57%), Positives = 46/68 (67%) Frame = +1 Query: 19 IFLVCQTTMRPSQFHKGSKNDHLLQRGLNQTPSATNHALVPWS*FIHQTWFLVSLELKDT 198 +F V Q PSQ K +KND LL + L + + NHALV IHQ+WFLVSLE+KDT Sbjct: 178 LFSVRQLLDHPSQ-PKLTKNDPLLSQ-LARANESINHALVEQPWLIHQSWFLVSLEVKDT 235 Query: 199 EVRAYRTD 222 EVRAYRTD Sbjct: 236 EVRAYRTD 243 >KVI08344.1 hypothetical protein Ccrd_013300 [Cynara cardunculus var. scolymus] Length = 75 Score = 57.0 bits (136), Expect = 4e-09 Identities = 27/49 (55%), Positives = 33/49 (67%) Frame = +1 Query: 76 NDHLLQRGLNQTPSATNHALVPWS*FIHQTWFLVSLELKDTEVRAYRTD 222 ND LL G++ + NHALV WS FI+ TW V L +K+ EVRAYRTD Sbjct: 21 NDPLLSHGIDYAMGSVNHALVTWSWFINLTWVSVFLGIKNAEVRAYRTD 69 >KJB22935.1 hypothetical protein B456_004G074800 [Gossypium raimondii] Length = 100 Score = 50.8 bits (120), Expect = 2e-06 Identities = 36/69 (52%), Positives = 41/69 (59%), Gaps = 4/69 (5%) Frame = -2 Query: 222 ICSIGSYLCILEF*GDKKPSLVDELRPWD*SVISSTWGLVQTSLQQMIVLGT----LVEL 55 ICSIGSYLC L+F D+ PSLVDE R D SVI+ G V L + G+ LV L Sbjct: 19 ICSIGSYLCFLKFKRDRIPSLVDEPRLCDLSVIT---GPVMPLLALLDRRGSFSACLVLL 75 Query: 54 RWSHGCLTD 28 SH CLTD Sbjct: 76 GRSHSCLTD 84 >XP_007161701.1 hypothetical protein PHAVU_001G090900g [Phaseolus vulgaris] ESW33695.1 hypothetical protein PHAVU_001G090900g [Phaseolus vulgaris] Length = 65 Score = 49.7 bits (117), Expect = 2e-06 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = +1 Query: 103 NQTPSATNHALVPWS*FIHQTWFLVSLELKDTEVRAYRTD 222 ++T NH L+ S FIHQT VSLELKDTEVRAYRTD Sbjct: 20 DKTHLTINHGLITGSWFIHQTSDPVSLELKDTEVRAYRTD 59 >XP_013453607.1 hypothetical protein MTR_5g024973 [Medicago truncatula] KEH27642.1 hypothetical protein MTR_5g024973 [Medicago truncatula] Length = 96 Score = 49.7 bits (117), Expect = 4e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +1 Query: 118 ATNHALVPWS*FIHQTWFLVSLELKDTEVRAYRTD 222 A NHAL+ S FIHQT+ VSLE+KDT VR+YRTD Sbjct: 27 AVNHALITRSWFIHQTYVPVSLEIKDTVVRSYRTD 61 >ONK76750.1 uncharacterized protein A4U43_C03F31720 [Asparagus officinalis] Length = 150 Score = 50.4 bits (119), Expect = 6e-06 Identities = 32/64 (50%), Positives = 38/64 (59%) Frame = +1 Query: 31 CQTTMRPSQFHKGSKNDHLLQRGLNQTPSATNHALVPWS*FIHQTWFLVSLELKDTEVRA 210 CQTT P Q K + +L ++ + NHAL P IHQT + VSLELKDT VRA Sbjct: 7 CQTTSGPPQQFKLLRM--ILYSFDQESATTVNHALSPRPRVIHQTDWHVSLELKDTVVRA 64 Query: 211 YRTD 222 YRTD Sbjct: 65 YRTD 68