BLASTX nr result
ID: Lithospermum23_contig00020780
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00020780 (239 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012846375.1 PREDICTED: methionine--tRNA ligase, mitochondrial... 62 1e-09 CDP20466.1 unnamed protein product [Coffea canephora] 57 5e-09 XP_013453607.1 hypothetical protein MTR_5g024973 [Medicago trunc... 52 7e-07 XP_013447472.1 hypothetical protein MTR_7g007390 [Medicago trunc... 50 6e-06 >XP_012846375.1 PREDICTED: methionine--tRNA ligase, mitochondrial, partial [Erythranthe guttata] Length = 817 Score = 62.4 bits (150), Expect = 1e-09 Identities = 33/64 (51%), Positives = 43/64 (67%) Frame = +2 Query: 23 SVRQP*NHPEPMKG*ERSSTTRGLEPSTQAVNHALVSQP*FIHQT*FLVSLELKDTDVRA 202 SVRQ +HP K + L + +++NHALV QP IHQ+ FLVSLE+KDT+VRA Sbjct: 180 SVRQLLDHPSQPKLTKNDPLLSQLARANESINHALVEQPWLIHQSWFLVSLEVKDTEVRA 239 Query: 203 YRTE 214 YRT+ Sbjct: 240 YRTD 243 >CDP20466.1 unnamed protein product [Coffea canephora] Length = 63 Score = 56.6 bits (135), Expect = 5e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 101 STQAVNHALVSQP*FIHQT*FLVSLELKDTDVRAYRTE 214 +T+AVNHALV + FIHQT F VSLELKDT+VRAYRT+ Sbjct: 20 ATRAVNHALVKRSYFIHQTWFPVSLELKDTEVRAYRTD 57 >XP_013453607.1 hypothetical protein MTR_5g024973 [Medicago truncatula] KEH27642.1 hypothetical protein MTR_5g024973 [Medicago truncatula] Length = 96 Score = 52.0 bits (123), Expect = 7e-07 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = +2 Query: 62 G*ERSSTTRGLEPSTQAVNHALVSQP*FIHQT*FLVSLELKDTDVRAYRTE 214 G ERSST AVNHAL+++ FIHQT VSLE+KDT VR+YRT+ Sbjct: 11 GRERSSTAEDDAHIILAVNHALITRSWFIHQTYVPVSLEIKDTVVRSYRTD 61 >XP_013447472.1 hypothetical protein MTR_7g007390 [Medicago truncatula] KEH21553.1 hypothetical protein MTR_7g007390 [Medicago truncatula] Length = 142 Score = 50.4 bits (119), Expect = 6e-06 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = +2 Query: 62 G*ERSSTTRGLEPSTQAVNHALVSQP*FIHQT*FLVSLELKDTDVRAYRTE 214 G ERSST AVNHAL+++ FIHQT VSLE+KDT VR+YR + Sbjct: 28 GQERSSTAEDDAHIIMAVNHALITRSWFIHQTYVPVSLEIKDTVVRSYRID 78