BLASTX nr result
ID: Lithospermum23_contig00020581
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00020581 (411 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYU23729.1 hypothetical protein MIMGU_mgv1a026953mg [Erythranthe... 42 2e-07 KZV19054.1 protein trichome birefringence-like 14 [Dorcoceras hy... 53 3e-06 >EYU23729.1 hypothetical protein MIMGU_mgv1a026953mg [Erythranthe guttata] Length = 481 Score = 42.0 bits (97), Expect(2) = 2e-07 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = +3 Query: 210 FLWSWENNPLVTSMLSAQEKFIVHT 284 F W+WE NPLV S+LSAQE+FI+ T Sbjct: 27 FFWAWEYNPLVISLLSAQEQFIMQT 51 Score = 40.4 bits (93), Expect(2) = 2e-07 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = +2 Query: 134 KTGSLSRYWGRQFSFTLAAIIFTTVFF 214 K G SR WGRQ SFT+AA++ TT+FF Sbjct: 2 KGGHSSRIWGRQSSFTVAALVITTIFF 28 >KZV19054.1 protein trichome birefringence-like 14 [Dorcoceras hygrometricum] Length = 129 Score = 53.1 bits (126), Expect = 3e-06 Identities = 27/86 (31%), Positives = 46/86 (53%) Frame = +2 Query: 134 KTGSLSRYWGRQFSFTLAAIIFTTVFFMVLGKQPTCYKYAISTRKVHRTYLRIFVDEAAE 313 K LSR+WGRQFSF +AA++FTT+FF P + + ++VD+AA+ Sbjct: 2 KGAQLSRFWGRQFSFIMAALVFTTMFFWCWESNPILMGLLSAPEQFATHTSDLYVDDAAD 61 Query: 314 SSILKPIEDGSKEFVPPEEAIRKEEH 391 SS + ++ E + + + + E+ Sbjct: 62 SSTMLNSKELLMEEISHSQVLERTEY 87