BLASTX nr result
ID: Lithospermum23_contig00020456
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00020456 (360 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012855754.1 PREDICTED: putative pentatricopeptide repeat-cont... 132 7e-34 OMO67436.1 hypothetical protein COLO4_30157 [Corchorus olitorius] 129 1e-32 CDP12753.1 unnamed protein product [Coffea canephora] 128 2e-32 XP_016683661.1 PREDICTED: putative pentatricopeptide repeat-cont... 128 2e-32 XP_012452895.1 PREDICTED: putative pentatricopeptide repeat-cont... 128 2e-32 XP_016446619.1 PREDICTED: putative pentatricopeptide repeat-cont... 127 3e-32 XP_009779890.1 PREDICTED: putative pentatricopeptide repeat-cont... 127 3e-32 XP_015162874.1 PREDICTED: putative pentatricopeptide repeat-cont... 127 4e-32 EOX98064.1 Tetratricopeptide repeat-like superfamily protein, pu... 128 4e-32 XP_017970334.1 PREDICTED: pentatricopeptide repeat-containing pr... 128 5e-32 XP_017645041.1 PREDICTED: putative pentatricopeptide repeat-cont... 127 6e-32 XP_011071912.1 PREDICTED: putative pentatricopeptide repeat-cont... 123 1e-30 ABK96162.1 unknown [Populus trichocarpa] 122 3e-30 XP_019243617.1 PREDICTED: putative pentatricopeptide repeat-cont... 122 3e-30 XP_015068259.1 PREDICTED: putative pentatricopeptide repeat-cont... 122 3e-30 XP_019154411.1 PREDICTED: putative pentatricopeptide repeat-cont... 121 6e-30 KDP31046.1 hypothetical protein JCGZ_11422 [Jatropha curcas] 121 8e-30 XP_004236539.1 PREDICTED: putative pentatricopeptide repeat-cont... 121 8e-30 XP_002322190.2 hypothetical protein POPTR_0015s09390g [Populus t... 121 1e-29 XP_012079996.1 PREDICTED: LOW QUALITY PROTEIN: putative pentatri... 121 1e-29 >XP_012855754.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Erythranthe guttata] EYU22166.1 hypothetical protein MIMGU_mgv1a003924mg [Erythranthe guttata] Length = 555 Score = 132 bits (332), Expect = 7e-34 Identities = 60/100 (60%), Positives = 80/100 (80%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 MN+HL +L +L+KPH T+ +T+ LHAL+ + S DPFYATK++R YA+NNDLISA NL Sbjct: 1 MNIHLNSILSQLTKPHHTISRTRILHALVIANSLSSDPFYATKILRLYAVNNDLISARNL 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQT 355 FD+TPQR+ FLWNSIIRAYA++ F AF+LFK + +S+T Sbjct: 61 FDRTPQRSVFLWNSIIRAYAQSHRFPDAFALFKRLLISET 100 >OMO67436.1 hypothetical protein COLO4_30157 [Corchorus olitorius] Length = 559 Score = 129 bits (323), Expect = 1e-32 Identities = 64/101 (63%), Positives = 78/101 (77%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 M + LL ELSKPHQT+ KT++LHAL+ K+H S DPF+ATKL+RFYALN+DL SA +L Sbjct: 1 MVFQIHSLLSELSKPHQTILKTKQLHALVTKTHLSLDPFFATKLVRFYALNDDLCSARHL 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQTK 358 FD+TPQR+ FLWNSIIRAYA+ FS A SLF M + TK Sbjct: 61 FDETPQRSVFLWNSIIRAYAQAHKFSDALSLFNKMLRTDTK 101 >CDP12753.1 unnamed protein product [Coffea canephora] Length = 550 Score = 128 bits (321), Expect = 2e-32 Identities = 62/93 (66%), Positives = 73/93 (78%) Frame = +2 Query: 77 LLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNLFDKTPQR 256 LL ELS+PH TL +TQ LHA I K+H S DPFYAT+L+R YA+NNDL SAH LFD+TPQR Sbjct: 8 LLSELSRPHHTLLRTQILHAFIIKTHLSRDPFYATRLVRLYAINNDLSSAHQLFDETPQR 67 Query: 257 TTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQT 355 + FLWNSIIRAYA+ FS AF+LFK M +T Sbjct: 68 SIFLWNSIIRAYAKTHLFSDAFALFKRMLSLET 100 >XP_016683661.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Gossypium hirsutum] Length = 552 Score = 128 bits (321), Expect = 2e-32 Identities = 63/101 (62%), Positives = 78/101 (77%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 M + LL ELSK HQT+ KT++LHALI+K+H S DPF+ATKL+RFYA+N+DL SA NL Sbjct: 1 MVFQIHSLLSELSKHHQTILKTKQLHALISKTHLSLDPFFATKLLRFYAINHDLCSARNL 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQTK 358 FDK PQR+ FLWNSIIRAYA+ F+ + SLF M S+TK Sbjct: 61 FDKAPQRSVFLWNSIIRAYAQAHHFNHSLSLFNQMLASETK 101 >XP_012452895.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Gossypium raimondii] XP_012452896.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Gossypium raimondii] KJB66570.1 hypothetical protein B456_010G143900 [Gossypium raimondii] Length = 552 Score = 128 bits (321), Expect = 2e-32 Identities = 63/101 (62%), Positives = 78/101 (77%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 M + LL ELSK HQT+ KT++LHALI+K+H S DPF+ATKL+RFYA+N+DL SA NL Sbjct: 1 MVFQIHSLLSELSKHHQTILKTKQLHALISKTHLSLDPFFATKLLRFYAINHDLCSARNL 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQTK 358 FDK PQR+ FLWNSIIRAYA+ F+ + SLF M S+TK Sbjct: 61 FDKAPQRSVFLWNSIIRAYAQAHHFNHSLSLFNQMLASETK 101 >XP_016446619.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana tabacum] XP_016446620.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana tabacum] XP_016446621.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana tabacum] XP_016446622.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana tabacum] XP_016446623.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana tabacum] XP_016446624.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana tabacum] XP_016446625.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana tabacum] XP_016446626.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana tabacum] XP_016446628.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana tabacum] XP_016446629.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana tabacum] XP_016446630.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana tabacum] XP_016446631.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana tabacum] XP_016446632.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana tabacum] Length = 555 Score = 127 bits (320), Expect = 3e-32 Identities = 61/101 (60%), Positives = 80/101 (79%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 M++ LL +LSK T+P+T++LHALI ++H S DPFYAT+++RFYALN+D+ISA NL Sbjct: 1 MSIPFHSLLSQLSKLKLTIPRTKELHALIIRTHLSCDPFYATRILRFYALNDDIISARNL 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQTK 358 FDKTP R+ +LWNS+IRAYAR F+ AFSLFKDM S+ K Sbjct: 61 FDKTPHRSIYLWNSLIRAYARAHKFTDAFSLFKDMLYSEIK 101 >XP_009779890.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana sylvestris] XP_009779892.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana sylvestris] XP_009779893.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana sylvestris] XP_009779894.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana sylvestris] XP_009779895.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana sylvestris] XP_009779896.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana sylvestris] XP_009779897.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana sylvestris] XP_009779898.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana sylvestris] XP_009779899.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana sylvestris] XP_009779900.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana sylvestris] XP_009779901.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana sylvestris] XP_009779902.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana sylvestris] XP_009779903.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana sylvestris] Length = 555 Score = 127 bits (320), Expect = 3e-32 Identities = 61/101 (60%), Positives = 80/101 (79%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 M++ LL +LSK T+P+T++LHALI ++H S DPFYAT+++RFYALN+D+ISA NL Sbjct: 1 MSIPFHSLLSQLSKLKLTIPRTKELHALIIRTHLSCDPFYATRILRFYALNDDIISARNL 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQTK 358 FDKTP R+ +LWNS+IRAYAR F+ AFSLFKDM S+ K Sbjct: 61 FDKTPHRSIYLWNSLIRAYARARKFTDAFSLFKDMLYSEIK 101 >XP_015162874.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Solanum tuberosum] Length = 559 Score = 127 bits (320), Expect = 4e-32 Identities = 61/99 (61%), Positives = 75/99 (75%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 M + LL +LSKP + +T++LHA I K+H S DPFYAT++IRFYALNND+ISAHNL Sbjct: 1 MFIPFNSLLAQLSKPKLPISRTKELHAFIIKTHLSHDPFYATRIIRFYALNNDIISAHNL 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQ 352 FDKTP R+ +LWNS+IRAYAR F AFSLF DM S+ Sbjct: 61 FDKTPHRSIYLWNSLIRAYARAHKFRNAFSLFNDMLYSE 99 >EOX98064.1 Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 625 Score = 128 bits (321), Expect = 4e-32 Identities = 64/101 (63%), Positives = 79/101 (78%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 M + LL ELSKPHQT+ KT+++HALIAK+ S DPF+ATKL+RFYA N+DL SAHNL Sbjct: 1 MLFQIHSLLSELSKPHQTILKTKQIHALIAKTRLSLDPFFATKLVRFYAHNDDLCSAHNL 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQTK 358 FD+TP R+ FLWNSIIRAYAR F+ A SLF+ M ++TK Sbjct: 61 FDETPARSVFLWNSIIRAYARARKFNDALSLFERMLGTETK 101 >XP_017970334.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic [Theobroma cacao] Length = 1179 Score = 128 bits (321), Expect = 5e-32 Identities = 64/101 (63%), Positives = 79/101 (78%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 M + LL ELSKPHQT+ KT+++HALIAK+ S DPF+ATKL+RFYA N+DL SAHNL Sbjct: 1 MLFQIHSLLSELSKPHQTILKTKQIHALIAKTRLSLDPFFATKLVRFYAHNDDLCSAHNL 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQTK 358 FD+TP R+ FLWNSIIRAYAR F+ A SLF+ M ++TK Sbjct: 61 FDETPARSVFLWNSIIRAYARARKFNDALSLFERMLGTETK 101 >XP_017645041.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Gossypium arboreum] Length = 552 Score = 127 bits (318), Expect = 6e-32 Identities = 62/101 (61%), Positives = 78/101 (77%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 M + LL ELSK HQT+ KT++LHALI+K+H S DPF+ATKL+RFYA+N+D+ SA NL Sbjct: 1 MVFQIHSLLSELSKHHQTILKTKQLHALISKTHLSLDPFFATKLLRFYAINHDVCSARNL 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQTK 358 FDK PQR+ FLWNSIIRAYA+ F+ + SLF M S+TK Sbjct: 61 FDKAPQRSVFLWNSIIRAYAQAHHFNHSLSLFNQMLASETK 101 >XP_011071912.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Sesamum indicum] Length = 552 Score = 123 bits (309), Expect = 1e-30 Identities = 60/101 (59%), Positives = 75/101 (74%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 M++H LL +L+KP+ TL T+ LHAL+ K S DPFYATK++RFYA+NNDLISAH + Sbjct: 1 MHIHFKSLLSQLTKPNHTLSATRILHALLIKQRLSSDPFYATKIVRFYAINNDLISAHIV 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQTK 358 FD TPQR+ FLWNSIIRAYA+ F AF LFK + S T+ Sbjct: 61 FDTTPQRSIFLWNSIIRAYAQVHKFCDAFLLFKGLLTSGTQ 101 >ABK96162.1 unknown [Populus trichocarpa] Length = 553 Score = 122 bits (306), Expect = 3e-30 Identities = 60/95 (63%), Positives = 71/95 (74%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 M + L +LSK HQTL +T++LHAL+ K+H DPFYATKL+RFYALNNDL SA NL Sbjct: 1 MLIKFQSLFLQLSKTHQTLSRTKQLHALVTKTHLLQDPFYATKLVRFYALNNDLSSARNL 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDM 340 FDKTPQR+ FLWNSIIRAYA+ F AF L+ M Sbjct: 61 FDKTPQRSVFLWNSIIRAYAQAHKFDDAFLLYTKM 95 >XP_019243617.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana attenuata] XP_019243618.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana attenuata] XP_019243619.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Nicotiana attenuata] OIT04851.1 putative pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 554 Score = 122 bits (306), Expect = 3e-30 Identities = 58/94 (61%), Positives = 75/94 (79%) Frame = +2 Query: 77 LLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNLFDKTPQR 256 LL +LSK T+ +T++LHA I ++H S DPFYAT+++RFYALN+D+ISA NLFDKTP R Sbjct: 8 LLSQLSKLKLTISRTKELHAFIMRTHLSHDPFYATRILRFYALNDDIISARNLFDKTPHR 67 Query: 257 TTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQTK 358 + +LWNS+IRAYAR F+ AFSLFKDM S+ K Sbjct: 68 SIYLWNSLIRAYARAHKFTDAFSLFKDMLYSEIK 101 >XP_015068259.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Solanum pennellii] XP_015068260.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Solanum pennellii] XP_015068261.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Solanum pennellii] XP_015068262.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Solanum pennellii] XP_015068263.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Solanum pennellii] Length = 555 Score = 122 bits (306), Expect = 3e-30 Identities = 59/99 (59%), Positives = 74/99 (74%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 M + L+ +LSK + +T++LHA I K+H S DPFYAT++IRFYALNND+ISAHNL Sbjct: 1 MFIPFNSLVAQLSKLKLPISRTKELHAFIIKTHLSQDPFYATRIIRFYALNNDIISAHNL 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQ 352 FDKTP R+ +LWNS+IRAYAR F AFSLF DM S+ Sbjct: 61 FDKTPHRSIYLWNSLIRAYARAHKFRNAFSLFNDMLHSE 99 >XP_019154411.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Ipomoea nil] XP_019154412.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Ipomoea nil] Length = 554 Score = 121 bits (304), Expect = 6e-30 Identities = 60/101 (59%), Positives = 75/101 (74%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 M + LL +LS+ +QT+ T+ LHA+I K+H S PFYAT++IRFYALN D++SA L Sbjct: 1 MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQTK 358 FD+TPQR+ FLWNSIIRAYAR FS AF LFKDM S T+ Sbjct: 61 FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTR 101 >KDP31046.1 hypothetical protein JCGZ_11422 [Jatropha curcas] Length = 555 Score = 121 bits (303), Expect = 8e-30 Identities = 58/101 (57%), Positives = 78/101 (77%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 M++ + LL EL+K HQT +T++LHALI +SH S + FYATK++RFYALN+DLISA+NL Sbjct: 1 MSVKFSSLLQELTKSHQTRSRTKQLHALILRSHLSHESFYATKILRFYALNDDLISAYNL 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQTK 358 FDKTPQR+ FLWNS+IRA+A+ F A S + M ++TK Sbjct: 61 FDKTPQRSIFLWNSMIRAFAKAHKFDEALSFYAKMLRTETK 101 >XP_004236539.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Solanum lycopersicum] XP_010319005.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Solanum lycopersicum] XP_010319006.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Solanum lycopersicum] XP_010319007.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Solanum lycopersicum] Length = 555 Score = 121 bits (303), Expect = 8e-30 Identities = 59/99 (59%), Positives = 72/99 (72%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 M + L+ +LSK + +T++LHA I K+H S DPFYATK+IRFYALNND+ISAH + Sbjct: 1 MFIPFNSLVAQLSKLKLPISRTKELHAFIIKTHLSQDPFYATKIIRFYALNNDIISAHKV 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQ 352 FDKTP RT +LWNS+IR YAR F AFSLF DM SQ Sbjct: 61 FDKTPHRTIYLWNSLIRGYARAHKFRNAFSLFNDMLHSQ 99 >XP_002322190.2 hypothetical protein POPTR_0015s09390g [Populus trichocarpa] EEF06317.2 hypothetical protein POPTR_0015s09390g [Populus trichocarpa] Length = 854 Score = 121 bits (304), Expect = 1e-29 Identities = 59/88 (67%), Positives = 69/88 (78%) Frame = +2 Query: 77 LLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNLFDKTPQR 256 L +LSK HQTL +T++LHAL+ K+H DPFYATKL+RFYALNNDL SA NLFDKTPQR Sbjct: 309 LFLQLSKTHQTLSRTKQLHALVTKTHLLQDPFYATKLVRFYALNNDLSSARNLFDKTPQR 368 Query: 257 TTFLWNSIIRAYARNGFFSTAFSLFKDM 340 + FLWNSIIRAYA+ F AF L+ M Sbjct: 369 SVFLWNSIIRAYAQAHKFDDAFLLYTKM 396 >XP_012079996.1 PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At1g64310 [Jatropha curcas] Length = 624 Score = 121 bits (303), Expect = 1e-29 Identities = 58/101 (57%), Positives = 78/101 (77%) Frame = +2 Query: 56 MNLHLTKLLPELSKPHQTLPKTQKLHALIAKSHHSDDPFYATKLIRFYALNNDLISAHNL 235 M++ + LL EL+K HQT +T++LHALI +SH S + FYATK++RFYALN+DLISA+NL Sbjct: 1 MSVKFSSLLQELTKSHQTRSRTKQLHALILRSHLSHESFYATKILRFYALNDDLISAYNL 60 Query: 236 FDKTPQRTTFLWNSIIRAYARNGFFSTAFSLFKDMFVSQTK 358 FDKTPQR+ FLWNS+IRA+A+ F A S + M ++TK Sbjct: 61 FDKTPQRSIFLWNSMIRAFAKAHKFDEALSFYAKMLRTETK 101