BLASTX nr result
ID: Lithospermum23_contig00020451
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00020451 (214 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP00224.1 unnamed protein product [Coffea canephora] 61 1e-10 KZV36334.1 hypothetical protein F511_25134 [Dorcoceras hygrometr... 54 5e-08 KZV36079.1 hypothetical protein F511_23276 [Dorcoceras hygrometr... 53 2e-07 >CDP00224.1 unnamed protein product [Coffea canephora] Length = 83 Score = 60.8 bits (146), Expect = 1e-10 Identities = 31/53 (58%), Positives = 38/53 (71%), Gaps = 6/53 (11%) Frame = +1 Query: 73 ENPWGRK------KNMGSTKRLGDPSPKLTKKMSEKFGKTKEVASSGMKKMKE 213 ENPW K+ KRLG PSPKL++K+SEKF +TKEVAS+GMKK+KE Sbjct: 9 ENPWSAANQNKAPKSPRQPKRLGGPSPKLSRKVSEKFERTKEVASAGMKKVKE 61 >KZV36334.1 hypothetical protein F511_25134 [Dorcoceras hygrometricum] Length = 89 Score = 54.3 bits (129), Expect = 5e-08 Identities = 28/51 (54%), Positives = 36/51 (70%), Gaps = 4/51 (7%) Frame = +1 Query: 73 ENPWGRK----KNMGSTKRLGDPSPKLTKKMSEKFGKTKEVASSGMKKMKE 213 ENP+G K +RLG PSPKL+K++SEKF +TKEVAS+GM+K E Sbjct: 6 ENPFGGSTASAKPAAEPRRLGGPSPKLSKRLSEKFERTKEVASAGMEKSVE 56 >KZV36079.1 hypothetical protein F511_23276 [Dorcoceras hygrometricum] Length = 91 Score = 53.1 bits (126), Expect = 2e-07 Identities = 23/50 (46%), Positives = 33/50 (66%) Frame = +1 Query: 61 MTFMENPWGRKKNMGSTKRLGDPSPKLTKKMSEKFGKTKEVASSGMKKMK 210 M +NPWG + RLG +PKL++K SE FG+TKEV ++G++K K Sbjct: 1 MASNDNPWGGSNAPANPSRLGGSNPKLSQKFSENFGRTKEVTATGVRKTK 50