BLASTX nr result
ID: Lithospermum23_contig00020410
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00020410 (250 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004511420.1 PREDICTED: uncharacterized protein LOC101500488 [... 49 2e-08 KNA20483.1 hypothetical protein SOVF_052030 [Spinacia oleracea] 51 5e-08 XP_020085010.1 uncharacterized protein LOC109707893 [Ananas como... 50 6e-08 OAY70269.1 hypothetical protein ACMD2_11848 [Ananas comosus] 50 6e-08 XP_002520054.1 PREDICTED: uncharacterized protein LOC8280489 [Ri... 49 8e-08 XP_010091270.1 hypothetical protein L484_010297 [Morus notabilis... 52 8e-08 XP_018811781.1 PREDICTED: uncharacterized protein LOC108984318 [... 53 5e-07 XP_017628085.1 PREDICTED: uncharacterized protein LOC108471033 [... 50 7e-07 XP_015067637.1 PREDICTED: uncharacterized protein LOC107012336 [... 55 8e-07 XP_006347586.1 PREDICTED: uncharacterized protein LOC102584391 [... 55 8e-07 XP_004235297.1 PREDICTED: uncharacterized protein LOC101252261 [... 55 8e-07 OIV94973.1 hypothetical protein TanjilG_22170 [Lupinus angustifo... 54 2e-06 XP_019420246.1 PREDICTED: uncharacterized protein LOC109330503 [... 54 2e-06 KYP52708.1 hypothetical protein KK1_025453 [Cajanus cajan] 54 2e-06 XP_012844250.1 PREDICTED: uncharacterized protein LOC105964266 [... 54 2e-06 XP_016564125.1 PREDICTED: uncharacterized protein LOC107862924 [... 54 2e-06 EYU45385.1 hypothetical protein MIMGU_mgv1a005830mg [Erythranthe... 54 2e-06 KDP39522.1 hypothetical protein JCGZ_02542 [Jatropha curcas] 53 3e-06 XP_019194913.1 PREDICTED: uncharacterized protein LOC109188760 [... 53 3e-06 KFK25912.1 hypothetical protein AALP_AA8G179200 [Arabis alpina] 53 3e-06 >XP_004511420.1 PREDICTED: uncharacterized protein LOC101500488 [Cicer arietinum] Length = 393 Score = 49.3 bits (116), Expect(2) = 2e-08 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLRVRQKKNLF 145 YEAGLLFA+LAF+PFCEAG +D +SL+ R +N F Sbjct: 297 YEAGLLFAYLAFVPFCEAGLLDGLSLQ-RLLENTF 330 Score = 36.6 bits (83), Expect(2) = 2e-08 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 56 LQRLLENTFKLDLEAARE 3 LQRLLENTF+LDLEAARE Sbjct: 322 LQRLLENTFRLDLEAARE 339 >KNA20483.1 hypothetical protein SOVF_052030 [Spinacia oleracea] Length = 430 Score = 50.8 bits (120), Expect(2) = 5e-08 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLRVRQKKNLF 145 YEAGLLFA+LAFIPFCE G MDS+SL+ R +N F Sbjct: 334 YEAGLLFAYLAFIPFCETGIMDSLSLQ-RLVENTF 367 Score = 33.5 bits (75), Expect(2) = 5e-08 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 56 LQRLLENTFKLDLEAARE 3 LQRL+ENTF+LDLEA RE Sbjct: 359 LQRLVENTFQLDLEAVRE 376 >XP_020085010.1 uncharacterized protein LOC109707893 [Ananas comosus] Length = 427 Score = 50.4 bits (119), Expect(2) = 6e-08 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLR 169 YEAGLLFA+LAF+PFCE G MDSISL+ Sbjct: 331 YEAGLLFAYLAFVPFCEMGIMDSISLQ 357 Score = 33.5 bits (75), Expect(2) = 6e-08 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -3 Query: 65 SDKLQRLLENTFKLDLEAARE 3 S LQRLLE+TF+LDL+AARE Sbjct: 353 SISLQRLLESTFQLDLDAARE 373 >OAY70269.1 hypothetical protein ACMD2_11848 [Ananas comosus] Length = 385 Score = 50.4 bits (119), Expect(2) = 6e-08 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLR 169 YEAGLLFA+LAF+PFCE G MDSISL+ Sbjct: 289 YEAGLLFAYLAFVPFCEMGIMDSISLQ 315 Score = 33.5 bits (75), Expect(2) = 6e-08 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -3 Query: 65 SDKLQRLLENTFKLDLEAARE 3 S LQRLLE+TF+LDL+AARE Sbjct: 311 SISLQRLLESTFQLDLDAARE 331 >XP_002520054.1 PREDICTED: uncharacterized protein LOC8280489 [Ricinus communis] EEF42378.1 ATP binding protein, putative [Ricinus communis] Length = 423 Score = 48.5 bits (114), Expect(2) = 8e-08 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLR 169 YEAGLLFA+ AF+PFCEAG MD +SL+ Sbjct: 327 YEAGLLFAYFAFVPFCEAGIMDGLSLQ 353 Score = 35.0 bits (79), Expect(2) = 8e-08 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 56 LQRLLENTFKLDLEAARE 3 LQRLLE+TFKLD+EAARE Sbjct: 352 LQRLLESTFKLDIEAARE 369 >XP_010091270.1 hypothetical protein L484_010297 [Morus notabilis] EXB44191.1 hypothetical protein L484_010297 [Morus notabilis] Length = 161 Score = 51.6 bits (122), Expect(2) = 8e-08 Identities = 21/28 (75%), Positives = 27/28 (96%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLRV 166 YEAGLLFA+LAF+PFCEAG +DS+SL++ Sbjct: 47 YEAGLLFAYLAFVPFCEAGVVDSLSLQI 74 Score = 32.0 bits (71), Expect(2) = 8e-08 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 53 QRLLENTFKLDLEAARE 3 QRLLE+TFKLD+EA RE Sbjct: 91 QRLLESTFKLDIEACRE 107 >XP_018811781.1 PREDICTED: uncharacterized protein LOC108984318 [Juglans regia] Length = 109 Score = 52.8 bits (125), Expect = 5e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLR 169 YEAGLLFA+LAFIPFCEAG MDSISL+ Sbjct: 13 YEAGLLFAYLAFIPFCEAGIMDSISLQ 39 >XP_017628085.1 PREDICTED: uncharacterized protein LOC108471033 [Gossypium arboreum] XP_017628087.1 PREDICTED: uncharacterized protein LOC108471033 [Gossypium arboreum] Length = 420 Score = 50.1 bits (118), Expect(2) = 7e-07 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLR 169 YEAGLLFA+LAF+PFCEAG MD +SL+ Sbjct: 324 YEAGLLFAYLAFVPFCEAGIMDGLSLQ 350 Score = 30.4 bits (67), Expect(2) = 7e-07 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 56 LQRLLENTFKLDLEAARE 3 LQRLLE+TFKLD+ A RE Sbjct: 349 LQRLLESTFKLDVMATRE 366 >XP_015067637.1 PREDICTED: uncharacterized protein LOC107012336 [Solanum pennellii] Length = 428 Score = 54.7 bits (130), Expect = 8e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLRVRQKKNLF 145 YEAGLLFA+LAF+PFCEAG MDSISLR R +N F Sbjct: 332 YEAGLLFAYLAFVPFCEAGVMDSISLR-RLLENTF 365 >XP_006347586.1 PREDICTED: uncharacterized protein LOC102584391 [Solanum tuberosum] Length = 428 Score = 54.7 bits (130), Expect = 8e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLRVRQKKNLF 145 YEAGLLFA+LAF+PFCEAG MDSISLR R +N F Sbjct: 332 YEAGLLFAYLAFVPFCEAGVMDSISLR-RLLENTF 365 >XP_004235297.1 PREDICTED: uncharacterized protein LOC101252261 [Solanum lycopersicum] Length = 428 Score = 54.7 bits (130), Expect = 8e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLRVRQKKNLF 145 YEAGLLFA+LAF+PFCEAG MDSISLR R +N F Sbjct: 332 YEAGLLFAYLAFVPFCEAGVMDSISLR-RLLENTF 365 >OIV94973.1 hypothetical protein TanjilG_22170 [Lupinus angustifolius] Length = 379 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLRVRQKKNLF 145 YEAGLLFA+LAF+PFCEAGAMDS+SL+ R +N F Sbjct: 283 YEAGLLFAYLAFVPFCEAGAMDSLSLQ-RLLENTF 316 >XP_019420246.1 PREDICTED: uncharacterized protein LOC109330503 [Lupinus angustifolius] XP_019420247.1 PREDICTED: uncharacterized protein LOC109330503 [Lupinus angustifolius] XP_019420248.1 PREDICTED: uncharacterized protein LOC109330503 [Lupinus angustifolius] Length = 400 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLRVRQKKNLF 145 YEAGLLFA+LAF+PFCEAGAMDS+SL+ R +N F Sbjct: 304 YEAGLLFAYLAFVPFCEAGAMDSLSLQ-RLLENTF 337 >KYP52708.1 hypothetical protein KK1_025453 [Cajanus cajan] Length = 412 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLRVRQKKNLF 145 YEAGLLFA+LAF+PFCEAGAMDS+SL+ R +N F Sbjct: 316 YEAGLLFAYLAFVPFCEAGAMDSLSLQ-RLLENTF 349 >XP_012844250.1 PREDICTED: uncharacterized protein LOC105964266 [Erythranthe guttata] Length = 414 Score = 53.5 bits (127), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLRVRQKKNLF 145 YEAGLLFA++AFIPFCEAG MDS+SLR R +N F Sbjct: 318 YEAGLLFAYMAFIPFCEAGVMDSLSLR-RLLENTF 351 >XP_016564125.1 PREDICTED: uncharacterized protein LOC107862924 [Capsicum annuum] Length = 420 Score = 53.5 bits (127), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLRVRQKKNLF 145 YEAGLLFA+LAF+PFC+AG MDSISLR R +N F Sbjct: 324 YEAGLLFAYLAFVPFCQAGVMDSISLR-RLLENTF 357 >EYU45385.1 hypothetical protein MIMGU_mgv1a005830mg [Erythranthe guttata] Length = 468 Score = 53.5 bits (127), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLRVRQKKNLF 145 YEAGLLFA++AFIPFCEAG MDS+SLR R +N F Sbjct: 372 YEAGLLFAYMAFIPFCEAGVMDSLSLR-RLLENTF 405 >KDP39522.1 hypothetical protein JCGZ_02542 [Jatropha curcas] Length = 361 Score = 53.1 bits (126), Expect = 3e-06 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLRV 166 YEAGLLFA+LAF+PFCEAG MDS+SL+V Sbjct: 330 YEAGLLFAYLAFVPFCEAGIMDSLSLQV 357 >XP_019194913.1 PREDICTED: uncharacterized protein LOC109188760 [Ipomoea nil] Length = 420 Score = 53.1 bits (126), Expect = 3e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLRVRQKKNLF 145 YEAGLLFA+LAFIPFCEAG MDS++LR R +N F Sbjct: 324 YEAGLLFAYLAFIPFCEAGVMDSLTLR-RLLENTF 357 >KFK25912.1 hypothetical protein AALP_AA8G179200 [Arabis alpina] Length = 420 Score = 53.1 bits (126), Expect = 3e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 249 YEAGLLFAFLAFIPFCEAGAMDSISLRVRQKKNLF 145 YEAGLLFA+LAF+PFCEAG MDSISL+ R +N F Sbjct: 324 YEAGLLFAYLAFVPFCEAGVMDSISLQ-RLLENTF 357