BLASTX nr result
ID: Lithospermum23_contig00020287
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00020287 (299 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019161220.1 PREDICTED: probable envelope ADP,ATP carrier prot... 52 9e-06 >XP_019161220.1 PREDICTED: probable envelope ADP,ATP carrier protein, chloroplastic [Ipomoea nil] Length = 379 Score = 52.4 bits (124), Expect = 9e-06 Identities = 31/68 (45%), Positives = 39/68 (57%) Frame = -2 Query: 205 VSRAIPGLELSNSNNIDNSRAIKHEEWQNKWLTSSYCFTPTNSGGSCNFACLSLVEKRAE 26 V R IPGL+LS N+R + E +N WLT S G+ NFAC+SL EKR E Sbjct: 10 VCREIPGLDLST-----NARNFEPEHRRNNWLTMS---------GAGNFACISLAEKREE 55 Query: 25 RQFLPTSA 2 ++F PT A Sbjct: 56 KEFSPTPA 63