BLASTX nr result
ID: Lithospermum23_contig00019983
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00019983 (363 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP74962.1 Sugar transport protein 13, partial [Cajanus cajan] 54 1e-06 OIW11171.1 hypothetical protein TanjilG_22978 [Lupinus angustifo... 55 2e-06 OIW11172.1 hypothetical protein TanjilG_22979 [Lupinus angustifo... 55 2e-06 XP_019444535.1 PREDICTED: sugar transport protein 13-like [Lupin... 55 2e-06 XP_016202334.1 PREDICTED: sugar transport protein 13 [Arachis ip... 55 2e-06 XP_015964766.1 PREDICTED: sugar transport protein 13-like [Arach... 55 2e-06 XP_006838270.1 PREDICTED: sugar transport protein 13 [Amborella ... 55 3e-06 XP_019447156.1 PREDICTED: sugar transport protein 13-like [Lupin... 54 4e-06 AAK73949.1 AT5g26340/F9D12_17 [Arabidopsis thaliana] AAN28848.1 ... 54 4e-06 XP_019083965.1 PREDICTED: sugar transport protein 13-like isofor... 54 4e-06 KRH27627.1 hypothetical protein GLYMA_11G004800 [Glycine max] 54 4e-06 KRH35542.1 hypothetical protein GLYMA_10G249500 [Glycine max] 54 4e-06 KHN15784.1 Sugar transport protein 13 [Glycine soja] 54 4e-06 KHN02703.1 Sugar transport protein 13 [Glycine soja] 54 4e-06 XP_007143231.1 hypothetical protein PHAVU_007G055100g [Phaseolus... 54 4e-06 XP_012069919.1 PREDICTED: sugar transport protein 13-like [Jatro... 54 4e-06 XP_006606047.1 PREDICTED: sugar transport protein 13-like [Glyci... 54 4e-06 BAU00794.1 hypothetical protein VIGAN_10242300 [Vigna angularis ... 54 4e-06 XP_017406676.1 PREDICTED: sugar transport protein 13 [Vigna angu... 54 4e-06 KHN35184.1 Sugar transport protein 13 [Glycine soja] 54 4e-06 >KYP74962.1 Sugar transport protein 13, partial [Cajanus cajan] Length = 164 Score = 54.3 bits (129), Expect = 1e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 99 LCSFLFHRIKGGWGWRLSLGLAGIPALLLTFGA 1 L ++ ++IKGGWGWRLSLGL G+PALLLT GA Sbjct: 36 LVNYATNKIKGGWGWRLSLGLGGLPALLLTLGA 68 >OIW11171.1 hypothetical protein TanjilG_22978 [Lupinus angustifolius] Length = 372 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 99 LCSFLFHRIKGGWGWRLSLGLAGIPALLLTFGA 1 L ++ ++IKGGWGWRLSLGLAGIPALLLT GA Sbjct: 167 LVNYGTNKIKGGWGWRLSLGLAGIPALLLTVGA 199 >OIW11172.1 hypothetical protein TanjilG_22979 [Lupinus angustifolius] Length = 503 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 99 LCSFLFHRIKGGWGWRLSLGLAGIPALLLTFGA 1 L ++ ++IKGGWGWRLSLGLAGIPALLLT GA Sbjct: 167 LVNYGTNKIKGGWGWRLSLGLAGIPALLLTVGA 199 >XP_019444535.1 PREDICTED: sugar transport protein 13-like [Lupinus angustifolius] Length = 524 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 99 LCSFLFHRIKGGWGWRLSLGLAGIPALLLTFGA 1 L ++ ++IKGGWGWRLSLGLAGIPALLLT GA Sbjct: 188 LVNYGTNKIKGGWGWRLSLGLAGIPALLLTVGA 220 >XP_016202334.1 PREDICTED: sugar transport protein 13 [Arachis ipaensis] Length = 524 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 99 LCSFLFHRIKGGWGWRLSLGLAGIPALLLTFGA 1 L ++ ++IKGGWGWRLSLGLAGIPALLLT GA Sbjct: 189 LVNYGTNKIKGGWGWRLSLGLAGIPALLLTVGA 221 >XP_015964766.1 PREDICTED: sugar transport protein 13-like [Arachis duranensis] Length = 524 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 99 LCSFLFHRIKGGWGWRLSLGLAGIPALLLTFGA 1 L ++ ++IKGGWGWRLSLGLAGIPALLLT GA Sbjct: 189 LVNYGTNKIKGGWGWRLSLGLAGIPALLLTVGA 221 >XP_006838270.1 PREDICTED: sugar transport protein 13 [Amborella trichopoda] ERN00839.1 hypothetical protein AMTR_s00103p00075300 [Amborella trichopoda] Length = 522 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 78 RIKGGWGWRLSLGLAGIPALLLTFGA 1 +IKGGWGWRLSLGLAGIPALLLT GA Sbjct: 195 KIKGGWGWRLSLGLAGIPALLLTIGA 220 >XP_019447156.1 PREDICTED: sugar transport protein 13-like [Lupinus angustifolius] Length = 202 Score = 53.5 bits (127), Expect = 4e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 75 IKGGWGWRLSLGLAGIPALLLTFGA 1 IKGGWGWRLSLGLAGIPALLLT GA Sbjct: 5 IKGGWGWRLSLGLAGIPALLLTVGA 29 >AAK73949.1 AT5g26340/F9D12_17 [Arabidopsis thaliana] AAN28848.1 At5g26340/F9D12_17 [Arabidopsis thaliana] Length = 344 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 78 RIKGGWGWRLSLGLAGIPALLLTFGA 1 +IKGGWGWRLSLGLAGIPALLLT GA Sbjct: 195 KIKGGWGWRLSLGLAGIPALLLTVGA 220 >XP_019083965.1 PREDICTED: sugar transport protein 13-like isoform X3 [Camelina sativa] Length = 413 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 78 RIKGGWGWRLSLGLAGIPALLLTFGA 1 +IKGGWGWRLSLGLAGIPALLLT GA Sbjct: 82 KIKGGWGWRLSLGLAGIPALLLTVGA 107 >KRH27627.1 hypothetical protein GLYMA_11G004800 [Glycine max] Length = 473 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 99 LCSFLFHRIKGGWGWRLSLGLAGIPALLLTFGA 1 L ++ ++IKGGWGWRLSLGLAGIPA+LLT GA Sbjct: 139 LVNYGTNKIKGGWGWRLSLGLAGIPAVLLTLGA 171 >KRH35542.1 hypothetical protein GLYMA_10G249500 [Glycine max] Length = 475 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 99 LCSFLFHRIKGGWGWRLSLGLAGIPALLLTFGA 1 L ++ ++IKGGWGWRLSLGL G+PALLLT GA Sbjct: 180 LVNYATNKIKGGWGWRLSLGLGGLPALLLTLGA 212 >KHN15784.1 Sugar transport protein 13 [Glycine soja] Length = 484 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 99 LCSFLFHRIKGGWGWRLSLGLAGIPALLLTFGA 1 L ++ ++IKGGWGWRLSLGL G+PALLLT GA Sbjct: 186 LVNYATNKIKGGWGWRLSLGLGGLPALLLTLGA 218 >KHN02703.1 Sugar transport protein 13 [Glycine soja] Length = 505 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 99 LCSFLFHRIKGGWGWRLSLGLAGIPALLLTFGA 1 L ++ ++IKGGWGWRLSLGL G+PALLLT GA Sbjct: 180 LVNYATNKIKGGWGWRLSLGLGGLPALLLTLGA 212 >XP_007143231.1 hypothetical protein PHAVU_007G055100g [Phaseolus vulgaris] ESW15225.1 hypothetical protein PHAVU_007G055100g [Phaseolus vulgaris] Length = 507 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 99 LCSFLFHRIKGGWGWRLSLGLAGIPALLLTFGA 1 L ++ ++IKGGWGWRLSLGL G+PALLLT GA Sbjct: 182 LVNYATNKIKGGWGWRLSLGLGGLPALLLTLGA 214 >XP_012069919.1 PREDICTED: sugar transport protein 13-like [Jatropha curcas] Length = 511 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 78 RIKGGWGWRLSLGLAGIPALLLTFGA 1 +IKGGWGWRLSLGLAGIPALLLT GA Sbjct: 195 KIKGGWGWRLSLGLAGIPALLLTVGA 220 >XP_006606047.1 PREDICTED: sugar transport protein 13-like [Glycine max] KRG91268.1 hypothetical protein GLYMA_20G144300 [Glycine max] Length = 512 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 99 LCSFLFHRIKGGWGWRLSLGLAGIPALLLTFGA 1 L ++ ++IKGGWGWRLSLGL G+PALLLT GA Sbjct: 186 LVNYATNKIKGGWGWRLSLGLGGLPALLLTLGA 218 >BAU00794.1 hypothetical protein VIGAN_10242300 [Vigna angularis var. angularis] Length = 518 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 99 LCSFLFHRIKGGWGWRLSLGLAGIPALLLTFGA 1 L ++ ++IKGGWGWRLSLGLAGIPAL+LT GA Sbjct: 188 LVNYGTNKIKGGWGWRLSLGLAGIPALMLTVGA 220 >XP_017406676.1 PREDICTED: sugar transport protein 13 [Vigna angularis] KOM26583.1 hypothetical protein LR48_Vigan303s000500 [Vigna angularis] Length = 518 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 99 LCSFLFHRIKGGWGWRLSLGLAGIPALLLTFGA 1 L ++ ++IKGGWGWRLSLGLAGIPAL+LT GA Sbjct: 188 LVNYGTNKIKGGWGWRLSLGLAGIPALMLTVGA 220 >KHN35184.1 Sugar transport protein 13 [Glycine soja] Length = 519 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 99 LCSFLFHRIKGGWGWRLSLGLAGIPALLLTFGA 1 L ++ ++IKGGWGWRLSLGLAGIPA+LLT GA Sbjct: 185 LVNYGTNKIKGGWGWRLSLGLAGIPAVLLTLGA 217