BLASTX nr result
ID: Lithospermum23_contig00018945
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00018945 (513 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EPS74072.1 hypothetical protein M569_00680, partial [Genlisea au... 55 9e-06 >EPS74072.1 hypothetical protein M569_00680, partial [Genlisea aurea] Length = 497 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = -3 Query: 403 VHAFQVETLSGVARIHRFATEIVDLPGQEGQRVAITLNCMISLD 272 VH+ VET SG+AR HRFATE VDLP +EG+RV +++ +S+D Sbjct: 206 VHSIVVETPSGMARTHRFATETVDLPAREGERVTVSVAAPLSVD 249