BLASTX nr result
ID: Lithospermum23_contig00018865
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00018865 (273 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AIY53016.1 NAC [Solanum melongena] 65 2e-10 NP_001233972.1 jasmonic acid 2 [Solanum lycopersicum] AAF04915.1... 65 2e-10 XP_016541783.1 PREDICTED: NAC domain-containing protein 72-like ... 65 2e-10 XP_015059411.1 PREDICTED: NAC domain-containing protein 72 [Sola... 65 2e-10 XP_009618124.1 PREDICTED: NAC domain-containing protein 72-like ... 65 2e-10 XP_019249831.1 PREDICTED: NAC domain-containing protein 72-like ... 65 2e-10 XP_009783061.1 PREDICTED: NAC domain-containing protein 72-like ... 65 2e-10 XP_016445819.1 PREDICTED: NAC domain-containing protein 72-like ... 65 2e-10 JAU83985.1 NAC domain-containing protein 19, partial [Noccaea ca... 62 3e-10 XP_014491333.1 PREDICTED: NAC domain-containing protein 72-like ... 65 3e-10 XP_017433508.1 PREDICTED: NAC domain-containing protein 72-like ... 65 3e-10 CDY26031.1 BnaC06g05930D [Brassica napus] 62 3e-10 BAT89593.1 hypothetical protein VIGAN_06058200 [Vigna angularis ... 65 3e-10 XP_010675611.1 PREDICTED: NAC domain-containing protein 72 [Beta... 65 3e-10 NP_567773.1 NAC (No Apical Meristem) domain transcriptional regu... 64 3e-10 XP_018447063.1 PREDICTED: NAC domain-containing protein 72-like ... 64 3e-10 XP_010433374.1 PREDICTED: NAC domain-containing protein 72 [Came... 64 3e-10 XP_013671595.1 PREDICTED: NAC domain-containing protein 72-like ... 64 3e-10 NP_001302512.1 NAC domain-containing protein 72-like [Brassica n... 64 3e-10 AAP35056.1 NAC-domain protein 485 [Brassica napus] 64 3e-10 >AIY53016.1 NAC [Solanum melongena] Length = 345 Score = 65.1 bits (157), Expect = 2e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 VQEKD L QLSLPPGFRFYPTDEELLVQYLCK Sbjct: 3 VQEKDPLLQLSLPPGFRFYPTDEELLVQYLCK 34 >NP_001233972.1 jasmonic acid 2 [Solanum lycopersicum] AAF04915.1 jasmonic acid 2 [Solanum lycopersicum] Length = 349 Score = 65.1 bits (157), Expect = 2e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 VQEKD L QLSLPPGFRFYPTDEELLVQYLCK Sbjct: 3 VQEKDPLLQLSLPPGFRFYPTDEELLVQYLCK 34 >XP_016541783.1 PREDICTED: NAC domain-containing protein 72-like [Capsicum annuum] Length = 350 Score = 65.1 bits (157), Expect = 2e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 VQEKD L QLSLPPGFRFYPTDEELLVQYLCK Sbjct: 3 VQEKDPLLQLSLPPGFRFYPTDEELLVQYLCK 34 >XP_015059411.1 PREDICTED: NAC domain-containing protein 72 [Solanum pennellii] Length = 350 Score = 65.1 bits (157), Expect = 2e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 VQEKD L QLSLPPGFRFYPTDEELLVQYLCK Sbjct: 3 VQEKDPLLQLSLPPGFRFYPTDEELLVQYLCK 34 >XP_009618124.1 PREDICTED: NAC domain-containing protein 72-like [Nicotiana tomentosiformis] XP_016440048.1 PREDICTED: NAC domain-containing protein 72-like [Nicotiana tabacum] Length = 352 Score = 65.1 bits (157), Expect = 2e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 VQEKD L QLSLPPGFRFYPTDEELLVQYLCK Sbjct: 3 VQEKDPLLQLSLPPGFRFYPTDEELLVQYLCK 34 >XP_019249831.1 PREDICTED: NAC domain-containing protein 72-like [Nicotiana attenuata] OIT00499.1 nac domain-containing protein 72 [Nicotiana attenuata] Length = 353 Score = 65.1 bits (157), Expect = 2e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 VQEKD L QLSLPPGFRFYPTDEELLVQYLCK Sbjct: 3 VQEKDPLLQLSLPPGFRFYPTDEELLVQYLCK 34 >XP_009783061.1 PREDICTED: NAC domain-containing protein 72-like [Nicotiana sylvestris] XP_016445820.1 PREDICTED: NAC domain-containing protein 72-like isoform X2 [Nicotiana tabacum] Length = 354 Score = 65.1 bits (157), Expect = 2e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 VQEKD L QLSLPPGFRFYPTDEELLVQYLCK Sbjct: 3 VQEKDPLLQLSLPPGFRFYPTDEELLVQYLCK 34 >XP_016445819.1 PREDICTED: NAC domain-containing protein 72-like isoform X1 [Nicotiana tabacum] Length = 361 Score = 65.1 bits (157), Expect = 2e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 VQEKD L QLSLPPGFRFYPTDEELLVQYLCK Sbjct: 3 VQEKDPLLQLSLPPGFRFYPTDEELLVQYLCK 34 >JAU83985.1 NAC domain-containing protein 19, partial [Noccaea caerulescens] Length = 146 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 +QE D LAQLSLPPGFRFYPTDEEL+VQYLC+ Sbjct: 4 IQETDPLAQLSLPPGFRFYPTDEELMVQYLCR 35 >XP_014491333.1 PREDICTED: NAC domain-containing protein 72-like [Vigna radiata var. radiata] Length = 336 Score = 64.7 bits (156), Expect = 3e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 VQE+D LAQLSLPPGFRFYPTDEELLVQYLC+ Sbjct: 3 VQERDPLAQLSLPPGFRFYPTDEELLVQYLCR 34 >XP_017433508.1 PREDICTED: NAC domain-containing protein 72-like [Vigna angularis] KOM49611.1 hypothetical protein LR48_Vigan08g043800 [Vigna angularis] Length = 336 Score = 64.7 bits (156), Expect = 3e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 VQE+D LAQLSLPPGFRFYPTDEELLVQYLC+ Sbjct: 3 VQERDPLAQLSLPPGFRFYPTDEELLVQYLCR 34 >CDY26031.1 BnaC06g05930D [Brassica napus] Length = 151 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 +QE D LAQLSLPPGFRFYPTDEEL+VQYLC+ Sbjct: 3 IQETDPLAQLSLPPGFRFYPTDEELMVQYLCR 34 >BAT89593.1 hypothetical protein VIGAN_06058200 [Vigna angularis var. angularis] Length = 352 Score = 64.7 bits (156), Expect = 3e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 VQE+D LAQLSLPPGFRFYPTDEELLVQYLC+ Sbjct: 3 VQERDPLAQLSLPPGFRFYPTDEELLVQYLCR 34 >XP_010675611.1 PREDICTED: NAC domain-containing protein 72 [Beta vulgaris subsp. vulgaris] KMT13029.1 hypothetical protein BVRB_4g087440 [Beta vulgaris subsp. vulgaris] Length = 364 Score = 64.7 bits (156), Expect = 3e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 VQ+KD LAQLSLPPGFRFYPTDEELLVQYLC+ Sbjct: 3 VQDKDPLAQLSLPPGFRFYPTDEELLVQYLCR 34 >NP_567773.1 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein [Arabidopsis thaliana] Q93VY3.1 RecName: Full=NAC domain-containing protein 72; Short=ANAC072; AltName: Full=Protein RESPONSIVE TO DESICCATION 26 AAL16305.1 AT4g27410/F27G19_10 [Arabidopsis thaliana] AAL09817.1 unknown protein [Arabidopsis thaliana] AAM14367.1 unknown protein [Arabidopsis thaliana] AAM65308.1 unknown [Arabidopsis thaliana] AAN60296.1 unknown [Arabidopsis thaliana] AEE85334.1 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein [Arabidopsis thaliana] Length = 297 Score = 64.3 bits (155), Expect = 3e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 V+EKD LAQLSLPPGFRFYPTDEELLVQYLC+ Sbjct: 3 VREKDPLAQLSLPPGFRFYPTDEELLVQYLCR 34 >XP_018447063.1 PREDICTED: NAC domain-containing protein 72-like [Raphanus sativus] Length = 299 Score = 64.3 bits (155), Expect = 3e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 V+EKD LAQLSLPPGFRFYPTDEELLVQYLC+ Sbjct: 3 VREKDPLAQLSLPPGFRFYPTDEELLVQYLCR 34 >XP_010433374.1 PREDICTED: NAC domain-containing protein 72 [Camelina sativa] Length = 300 Score = 64.3 bits (155), Expect = 3e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 V+EKD LAQLSLPPGFRFYPTDEELLVQYLC+ Sbjct: 3 VREKDPLAQLSLPPGFRFYPTDEELLVQYLCR 34 >XP_013671595.1 PREDICTED: NAC domain-containing protein 72-like isoform X1 [Brassica napus] CDY29303.1 BnaC01g19550D [Brassica napus] Length = 300 Score = 64.3 bits (155), Expect = 3e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 V+EKD LAQLSLPPGFRFYPTDEELLVQYLC+ Sbjct: 3 VREKDPLAQLSLPPGFRFYPTDEELLVQYLCR 34 >NP_001302512.1 NAC domain-containing protein 72-like [Brassica napus] XP_009143398.1 PREDICTED: NAC domain-containing protein 72-like [Brassica rapa] AHN60144.1 NAC transcription factor 72 [Brassica napus] CDX89253.1 BnaA01g16400D [Brassica napus] Length = 300 Score = 64.3 bits (155), Expect = 3e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 V+EKD LAQLSLPPGFRFYPTDEELLVQYLC+ Sbjct: 3 VREKDPLAQLSLPPGFRFYPTDEELLVQYLCR 34 >AAP35056.1 NAC-domain protein 485 [Brassica napus] Length = 300 Score = 64.3 bits (155), Expect = 3e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 176 VQEKDHLAQLSLPPGFRFYPTDEELLVQYLCK 271 V+EKD LAQLSLPPGFRFYPTDEELLVQYLC+ Sbjct: 3 VREKDPLAQLSLPPGFRFYPTDEELLVQYLCR 34