BLASTX nr result
ID: Lithospermum23_contig00018749
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00018749 (248 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010682684.1 PREDICTED: NAC domain-containing protein 83 [Beta... 53 3e-06 KOM28455.1 hypothetical protein LR48_Vigan549s001000 [Vigna angu... 52 4e-06 KJB77205.1 hypothetical protein B456_012G125500 [Gossypium raimo... 52 5e-06 XP_017409065.1 PREDICTED: NAC domain-containing protein 83-like ... 52 5e-06 XP_009336457.1 PREDICTED: NAC domain-containing protein 83-like ... 52 6e-06 XP_008389924.1 PREDICTED: NAC domain-containing protein 83-like ... 52 6e-06 AGT01909.1 NAC transcription factor [Camellia sinensis] 52 7e-06 XP_019181155.1 PREDICTED: NAC domain-containing protein 83-like ... 52 8e-06 NP_001313796.1 NAC domain-containing protein 83 [Gossypium hirsu... 52 8e-06 XP_002512632.1 PREDICTED: NAC domain-containing protein 83 [Rici... 52 8e-06 XP_019181154.1 PREDICTED: NAC domain-containing protein 83-like ... 52 8e-06 AKE81095.1 apical meristem (NAM) family protein [Populus tomentosa] 52 8e-06 XP_011036132.1 PREDICTED: NAC domain-containing protein 18-like ... 52 8e-06 XP_002297860.1 no apical meristem family protein [Populus tricho... 52 8e-06 XP_008222225.1 PREDICTED: NAC domain-containing protein 83 [Prun... 52 8e-06 XP_007223645.1 hypothetical protein PRUPE_ppa010222mg [Prunus pe... 52 8e-06 >XP_010682684.1 PREDICTED: NAC domain-containing protein 83 [Beta vulgaris subsp. vulgaris] KMT07378.1 hypothetical protein BVRB_6g150040 [Beta vulgaris subsp. vulgaris] Length = 303 Score = 52.8 bits (125), Expect = 3e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +2 Query: 176 MERLSFVKDGVLRLPPGFRFHPTD 247 MER++FVKDGVLRLPPGFRFHPTD Sbjct: 1 MERMNFVKDGVLRLPPGFRFHPTD 24 >KOM28455.1 hypothetical protein LR48_Vigan549s001000 [Vigna angularis] Length = 266 Score = 52.4 bits (124), Expect = 4e-06 Identities = 28/48 (58%), Positives = 35/48 (72%), Gaps = 5/48 (10%) Frame = +2 Query: 119 LCSFRNNF*LVNIFLV--EFG---MERLSFVKDGVLRLPPGFRFHPTD 247 LCS R + ++ IF+ E G ME+L+FVK+G LRLPPGFRFHPTD Sbjct: 81 LCSSRTHKTILTIFIYREEVGRGRMEKLNFVKNGELRLPPGFRFHPTD 128 >KJB77205.1 hypothetical protein B456_012G125500 [Gossypium raimondii] Length = 182 Score = 51.6 bits (122), Expect = 5e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +2 Query: 176 MERLSFVKDGVLRLPPGFRFHPTD 247 ME+LSFVK+GVLRLPPGFRFHPTD Sbjct: 1 MEKLSFVKNGVLRLPPGFRFHPTD 24 >XP_017409065.1 PREDICTED: NAC domain-containing protein 83-like [Vigna angularis] BAT82929.1 hypothetical protein VIGAN_04001400 [Vigna angularis var. angularis] Length = 336 Score = 52.4 bits (124), Expect = 5e-06 Identities = 28/48 (58%), Positives = 35/48 (72%), Gaps = 5/48 (10%) Frame = +2 Query: 119 LCSFRNNF*LVNIFLV--EFG---MERLSFVKDGVLRLPPGFRFHPTD 247 LCS R + ++ IF+ E G ME+L+FVK+G LRLPPGFRFHPTD Sbjct: 81 LCSSRTHKTILTIFIYREEVGRGRMEKLNFVKNGELRLPPGFRFHPTD 128 >XP_009336457.1 PREDICTED: NAC domain-containing protein 83-like [Pyrus x bretschneideri] Length = 255 Score = 52.0 bits (123), Expect = 6e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +2 Query: 176 MERLSFVKDGVLRLPPGFRFHPTD 247 MER+SFVK+GVLRLPPGFRFHPTD Sbjct: 1 MERISFVKNGVLRLPPGFRFHPTD 24 >XP_008389924.1 PREDICTED: NAC domain-containing protein 83-like [Malus domestica] Length = 255 Score = 52.0 bits (123), Expect = 6e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +2 Query: 176 MERLSFVKDGVLRLPPGFRFHPTD 247 MER+SFVK+GVLRLPPGFRFHPTD Sbjct: 1 MERISFVKNGVLRLPPGFRFHPTD 24 >AGT01909.1 NAC transcription factor [Camellia sinensis] Length = 231 Score = 51.6 bits (122), Expect = 7e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +2 Query: 176 MERLSFVKDGVLRLPPGFRFHPTD 247 ME+LSFVK+GVLRLPPGFRFHPTD Sbjct: 1 MEKLSFVKNGVLRLPPGFRFHPTD 24 >XP_019181155.1 PREDICTED: NAC domain-containing protein 83-like isoform X2 [Ipomoea nil] Length = 248 Score = 51.6 bits (122), Expect = 8e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +2 Query: 176 MERLSFVKDGVLRLPPGFRFHPTD 247 ME+LSFVK+GVLRLPPGFRFHPTD Sbjct: 1 MEKLSFVKNGVLRLPPGFRFHPTD 24 >NP_001313796.1 NAC domain-containing protein 83 [Gossypium hirsutum] XP_012459997.1 PREDICTED: NAC transcription factor 25 [Gossypium raimondii] AHJ79193.1 NAC domain protein NAC52 [Gossypium hirsutum] KJB77204.1 hypothetical protein B456_012G125500 [Gossypium raimondii] Length = 254 Score = 51.6 bits (122), Expect = 8e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +2 Query: 176 MERLSFVKDGVLRLPPGFRFHPTD 247 ME+LSFVK+GVLRLPPGFRFHPTD Sbjct: 1 MEKLSFVKNGVLRLPPGFRFHPTD 24 >XP_002512632.1 PREDICTED: NAC domain-containing protein 83 [Ricinus communis] EEF50084.1 NAC domain-containing protein, putative [Ricinus communis] Length = 254 Score = 51.6 bits (122), Expect = 8e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +2 Query: 176 MERLSFVKDGVLRLPPGFRFHPTD 247 MERL+FVK+GVLRLPPGFRFHPTD Sbjct: 1 MERLNFVKNGVLRLPPGFRFHPTD 24 >XP_019181154.1 PREDICTED: NAC domain-containing protein 83-like isoform X1 [Ipomoea nil] Length = 255 Score = 51.6 bits (122), Expect = 8e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +2 Query: 176 MERLSFVKDGVLRLPPGFRFHPTD 247 ME+LSFVK+GVLRLPPGFRFHPTD Sbjct: 1 MEKLSFVKNGVLRLPPGFRFHPTD 24 >AKE81095.1 apical meristem (NAM) family protein [Populus tomentosa] Length = 257 Score = 51.6 bits (122), Expect = 8e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +2 Query: 176 MERLSFVKDGVLRLPPGFRFHPTD 247 ME+LSFVK+GVLRLPPGFRFHPTD Sbjct: 1 MEKLSFVKNGVLRLPPGFRFHPTD 24 >XP_011036132.1 PREDICTED: NAC domain-containing protein 18-like [Populus euphratica] Length = 257 Score = 51.6 bits (122), Expect = 8e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +2 Query: 176 MERLSFVKDGVLRLPPGFRFHPTD 247 ME+LSFVK+GVLRLPPGFRFHPTD Sbjct: 1 MEKLSFVKNGVLRLPPGFRFHPTD 24 >XP_002297860.1 no apical meristem family protein [Populus trichocarpa] EEE82665.1 no apical meristem family protein [Populus trichocarpa] Length = 257 Score = 51.6 bits (122), Expect = 8e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +2 Query: 176 MERLSFVKDGVLRLPPGFRFHPTD 247 ME+LSFVK+GVLRLPPGFRFHPTD Sbjct: 1 MEKLSFVKNGVLRLPPGFRFHPTD 24 >XP_008222225.1 PREDICTED: NAC domain-containing protein 83 [Prunus mume] Length = 258 Score = 51.6 bits (122), Expect = 8e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +2 Query: 176 MERLSFVKDGVLRLPPGFRFHPTD 247 MERL+FVK+GVLRLPPGFRFHPTD Sbjct: 1 MERLNFVKNGVLRLPPGFRFHPTD 24 >XP_007223645.1 hypothetical protein PRUPE_ppa010222mg [Prunus persica] ONI29894.1 hypothetical protein PRUPE_1G220400 [Prunus persica] Length = 258 Score = 51.6 bits (122), Expect = 8e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +2 Query: 176 MERLSFVKDGVLRLPPGFRFHPTD 247 MERL+FVK+GVLRLPPGFRFHPTD Sbjct: 1 MERLNFVKNGVLRLPPGFRFHPTD 24