BLASTX nr result
ID: Lithospermum23_contig00018613
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00018613 (613 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ADD63027.1 photosystem II protein M (chloroplast) [Potamophila p... 84 5e-18 AAS46110.1 photosystem II M protein (chloroplast) [Oryza sativa ... 84 5e-18 ADD63094.1 photosystem II protein M (chloroplast) [Microlaena st... 78 8e-16 KJB13068.1 hypothetical protein B456_002G055100 [Gossypium raimo... 74 2e-14 KJB80637.1 hypothetical protein B456_013G108100 [Gossypium raimo... 72 2e-13 AKF01761.1 photosystem II protein M (chloroplast) [Iriartea delt... 67 7e-12 YP_398315.1 photosystem II reaction center M protein [Lactuca sa... 67 1e-11 YP_009145255.1 photosystem II protein M (plastid) [Trillium decu... 67 1e-11 YP_009262745.1 photosystem II protein M (chloroplast) [Ludisia d... 66 1e-11 YP_009154945.1 photosystem II M protein (chloroplast) [Gentiana ... 66 1e-11 YP_009108837.1 photosystem II protein M [Pentalinon luteum] YP_0... 66 1e-11 YP_009092297.1 photosystem II protein M (chloroplast) [Macadamia... 66 1e-11 AMC31876.1 photosystem II protein M (chloroplast) [Cleomella ser... 66 2e-11 ANP95893.1 photosystem II protein M (plastid) [Pyrola rotundifolia] 66 2e-11 YP_009169759.1 photosystem II protein M (chloroplast) [Gynochtho... 65 3e-11 NP_114247.1 photosystem II M protein (chloroplast) [Triticum aes... 65 3e-11 ANO44774.1 photosystem II protein M (chloroplast) [Clintonia bor... 65 4e-11 YP_009054213.1 photosystem II protein M (chloroplast) [Fritillar... 65 4e-11 YP_002608408.1 PSII M protein [Vitis vinifera] CAQ77678.1 PSII M... 65 4e-11 YP_874641.1 photosystem II protein M (chloroplast) [Hordeum vulg... 65 4e-11 >ADD63027.1 photosystem II protein M (chloroplast) [Potamophila parviflora] Length = 69 Score = 84.0 bits (206), Expect = 5e-18 Identities = 44/52 (84%), Positives = 46/52 (88%) Frame = -2 Query: 366 SLWDQIPSYCEVKKNDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 S WD IPSYCE K E+MEVNILAFIATALFILVPTAFLLIIYVKTVSQN+ Sbjct: 21 SPWDYIPSYCEKK---EVMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 69 >AAS46110.1 photosystem II M protein (chloroplast) [Oryza sativa Japonica Group] AAS46173.1 photosystem II M protein (chloroplast) [Oryza sativa Japonica Group] ADD62823.1 photosystem II protein M (chloroplast) [Oryza sativa Japonica Group] ADD62891.1 photosystem II protein M (chloroplast) [Oryza meridionalis] ADD62959.1 photosystem II protein M (chloroplast) [Oryza australiensis] AGY48933.1 photosystem II reaction center protein M (chloroplast) [Oryza rufipogon] Length = 69 Score = 84.0 bits (206), Expect = 5e-18 Identities = 44/52 (84%), Positives = 46/52 (88%) Frame = -2 Query: 366 SLWDQIPSYCEVKKNDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 S WD IPSYCE K E+MEVNILAFIATALFILVPTAFLLIIYVKTVSQN+ Sbjct: 21 SPWDYIPSYCEKK---EVMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 69 >ADD63094.1 photosystem II protein M (chloroplast) [Microlaena stipoides] Length = 69 Score = 78.2 bits (191), Expect = 8e-16 Identities = 42/52 (80%), Positives = 44/52 (84%) Frame = -2 Query: 366 SLWDQIPSYCEVKKNDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 S WD IPSY E K E+MEVNILAFIATALFILVPTAFLLIIYVKT SQN+ Sbjct: 21 SPWDYIPSYYEKK---EVMEVNILAFIATALFILVPTAFLLIIYVKTASQND 69 >KJB13068.1 hypothetical protein B456_002G055100 [Gossypium raimondii] Length = 50 Score = 73.9 bits (180), Expect = 2e-14 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -2 Query: 348 PSYCEVKKNDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 P KKN+EIMEVNILAFIATALFILVPTAFLLIIYVKTVSQ++ Sbjct: 5 PELLRSKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQSD 50 >KJB80637.1 hypothetical protein B456_013G108100 [Gossypium raimondii] Length = 50 Score = 71.6 bits (174), Expect = 2e-13 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 348 PSYCEVKKNDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 P KKN+EIMEVNILAFIATALFILVPTAFLLIIYVKT+ Q++ Sbjct: 5 PELLRSKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTICQSD 50 >AKF01761.1 photosystem II protein M (chloroplast) [Iriartea deltoidea] Length = 35 Score = 67.0 bits (162), Expect = 7e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 315 IMEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 +MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN Sbjct: 1 MMEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 35 >YP_398315.1 photosystem II reaction center M protein [Lactuca sativa] YP_567070.1 photosystem II protein M (chloroplast) [Vitis vinifera] YP_817476.1 photosystem II protein M [Coffea arabica] YP_001123193.1 PSII low MW protein [Arabis hirsuta] YP_001123544.1 PSII low MW protein [Draba nemorosa] YP_001123719.1 photosystem II protein M [Lobularia maritima] YP_001718682.1 photosystem II protein M [Trachelium caeruleum] YP_002000476.1 photosystem II protein M (chloroplast) [Brachypodium distachyon] YP_004465174.1 photosystem II protein M [Jacobaea vulgaris] YP_005089946.1 psbM gene product (chloroplast) [Brassica napus] YP_007353752.1 photosystem II M protein (chloroplast) [Chrysanthemum x morifolium] YP_007474715.1 PsbM (chloroplast) [Chrysanthemum indicum] YP_007624781.1 photosystem II reaction center M protein (chloroplast) [Artemisia frigida] YP_008963389.1 photosystem II protein M (chloroplast) [Sedum sarmentosum] YP_009000326.1 psbM protein (chloroplast) [Arabis alpina] YP_008999929.1 photosystem II protein M (chloroplast) [Agrostemma githago] YP_009019785.1 photosystem II protein M (chloroplast) [Vitis rotundifolia] YP_009046908.1 photosystem II protein M (chloroplast) [Raphanus sativus] YP_009048569.1 photosystem II protein M [Paris verticillata] YP_009053990.1 photosystem II reaction center M protein (chloroplast) [Hanabusaya asiatica] YP_009111723.1 photosystem II reaction center M protein (chloroplast) [Artemisia montana] YP_009116007.1 photosystem II reaction center M protein (chloroplast) [Campanula takesimana] YP_009130036.1 photosystem II protein M (chloroplast) [Campynema lineare] YP_009129425.1 photosystem II protein M (chloroplast) [Goodyera fumata] YP_009135597.1 photosystem II protein M (plastid) [Zizania aquatica] YP_009136983.1 photosystem II reaction center M protein (chloroplast) [Adenophora remotiflora] YP_009142566.1 photosystem II protein M (plastid) [Trillium cuneatum] YP_009160796.1 photosystem II protein M (chloroplast) [Haloxylon ammodendron] YP_009160881.1 photosystem II protein M (chloroplast) [Haloxylon persicum] YP_009163190.1 photosystem II protein M (plastid) [Trillium maculatum] YP_009163273.1 photosystem II protein M (plastid) [Trillium tschonoskii] YP_009166877.1 photosystem II protein M (chloroplast) [Osyris alba] YP_009177859.1 photosystem II protein M (chloroplast) [Brassica juncea] YP_009179724.1 PSII low MW protein (chloroplast) [Isatis tinctoria] YP_009186603.1 photosystem II protein M (plastid) [Brighamia insignis] YP_009192695.1 photosystem II protein M (chloroplast) [Schrenkiella parvula] YP_009221801.1 photosystem II protein M (chloroplast) [Mesembryanthemum crystallinum] YP_009229675.1 photosystem II protein M (chloroplast) [Cochlearia borzaeana] YP_009229758.1 photosystem II protein M (chloroplast) [Cochlearia islandica] YP_009230565.1 photosystem II protein M (chloroplast) [Cochlearia pyrenaica] YP_009230648.1 photosystem II protein M (chloroplast) [Cochlearia tridactylites] YP_009230731.1 photosystem II protein M (chloroplast) [Ionopsidium acaule] YP_009231241.1 photosystem II protein M (chloroplast) [Tetrastigma hemsleyanum] YP_009231905.1 photosystem II protein M (chloroplast) [Goodyera velutina] YP_009233248.1 photosystem II protein M (chloroplast) [Zizania latifolia] YP_009234976.1 photosystem II protein M (chloroplast) [Papaver somniferum] YP_009235337.1 photosystem II protein M (chloroplast) [Vitis aestivalis] YP_009239193.1 photosystem II protein M (chloroplast) [Pedicularis ishidoyana] YP_009251119.1 photosystem II protein M (chloroplast) [Coffea canephora] YP_009258960.1 photosystem II protein M (chloroplast) [Spathiphyllum kochii] YP_009259573.1 PsbM (chloroplast) [Brassica nigra] YP_009261690.1 photosystem II protein M (chloroplast) [Pugionium dolabratum] YP_009261775.1 photosystem II protein M (chloroplast) [Pugionium cornutum] YP_009271368.1 PsbM (chloroplast) [Taraxacum officinale] YP_009271561.1 photosystem II protein M (chloroplast) [Cakile arabica] YP_009272063.1 PsbM (chloroplast) [Artemisia argyi] YP_009294957.1 photosystem II M protein (chloroplast) [Swertia mussotii] YP_009306932.1 photosystem II protein M (chloroplast) [Vitis amurensis] YP_009307465.1 PsbM (chloroplast) [Taraxacum platycarpum] YP_009307552.1 PsbM (chloroplast) [Taraxacum mongolicum] YP_009307738.1 PsbM (chloroplast) [Artemisia gmelinii] YP_009307826.1 PsbM (chloroplast) [Artemisia capillaris] YP_009316531.1 photosystem II protein M (chloroplast) [Taraxacum obtusifrons] YP_009316616.1 photosystem II protein M (chloroplast) [Taraxacum amplum] YP_009320266.1 photosystem II protein M (chloroplast) [Pericallis hybrida] YP_009326107.1 photosystem II protein M (chloroplast) [Oxyria sinensis] YP_009327472.1 photosystem II protein M (chloroplast) [Taraxacum brevicorniculatum] YP_009327554.1 photosystem II protein M (chloroplast) [Taraxacum kok-saghyz] YP_009338063.1 photosystem II reaction center M protein (plastid) [Campanula punctata] YP_009339339.1 photosystem II protein M (plastid) [Cyanea fissa] YP_009339429.1 photosystem II protein M (plastid) [Delissea rhytidosperma] YP_009339519.1 photosystem II protein M (plastid) [Lithotoma petraea] YP_009339598.1 photosystem II protein M (plastid) [Lobelia anceps] YP_009339695.1 photosystem II protein M (plastid) [Lobelia boninensis] YP_009339785.1 photosystem II protein M (plastid) [Lobelia inflata] YP_009339874.1 photosystem II protein M (plastid) [Lobelia jasionoides] YP_009339964.1 photosystem II protein M (plastid) [Lobelia laxiflora] YP_009340053.1 photosystem II protein M (plastid) [Lobelia longisepala] YP_009340141.1 photosystem II protein M (plastid) [Lobelia morogoroensis] YP_009340230.1 photosystem II protein M (plastid) [Lobelia polyphylla] YP_009340320.1 photosystem II protein M (plastid) [Lobelia stricklandiae] YP_009340410.1 photosystem II protein M (plastid) [Lobelia thuliniana] YP_009340562.1 photosystem II protein M (plastid) [Wimmerella hederacea] YP_009343436.1 photosystem II protein M (chloroplast) [Paris mairei] YP_009342501.1 photosystem II protein M (chloroplast) [Orychophragmus diffusus] YP_009342586.1 photosystem II protein M (chloroplast) [Orychophragmus taibaiensis] YP_009342671.1 photosystem II protein M (chloroplast) [Orychophragmus hupehensis] YP_009343100.1 photosystem II protein M (chloroplast) [Paris cronquistii] YP_009343183.1 photosystem II protein M (chloroplast) [Daiswa dunniana] YP_009343266.1 photosystem II protein M (chloroplast) [Daiswa forrestii] YP_009343352.1 photosystem II protein M (chloroplast) [Paris luquanensis] YP_009343520.1 photosystem II protein M (chloroplast) [Paris marmorata] YP_009343688.1 photosystem II protein M (chloroplast) [Daiswa yunnanensis] YP_009343772.1 photosystem II protein M (chloroplast) [Paris vietnamensis] YP_009343858.1 photosystem II protein M (chloroplast) [Paris quadrifolia] Q56P14.1 RecName: Full=Photosystem II reaction center protein M; Short=PSII-M (chloroplast) [Lactuca sativa] A0A329.1 RecName: Full=Photosystem II reaction center protein M; Short=PSII-M (chloroplast) [Coffea arabica] Q0ZJ26.1 RecName: Full=Photosystem II reaction center protein M; Short=PSII-M A4QK12.1 RecName: Full=Photosystem II reaction center protein M; Short=PSII-M (chloroplast) [Arabis hirsuta] A4QL13.1 RecName: Full=Photosystem II reaction center protein M; Short=PSII-M (chloroplast) [Draba nemorosa] A4QLI8.1 RecName: Full=Photosystem II reaction center protein M; Short=PSII-M (chloroplast) [Lobularia maritima] AAX58141.1 PSII M protein (chloroplast) [Lactuca sativa] BAE47580.1 photosystem II reaction center M protein (chloroplast) [Lactuca sativa] ABD47219.1 photosystem II protein M (chloroplast) [Lactuca sativa] ABE47528.1 photosystem II protein M (chloroplast) [Vitis vinifera] ABJ89673.1 photosystem II protein M (chloroplast) [Coffea arabica] BAF50017.1 PSII low MW protein (chloroplast) [Arabis hirsuta] BAF50368.1 PSII low MW protein (chloroplast) [Draba nemorosa] BAF50543.1 PSII low MW protein (chloroplast) [Lobularia maritima] ABU85654.1 photosystem II protein M, partial (chloroplast) [Trachelium caeruleum] ABV26507.1 photosystem II protein M (chloroplast) [Trachelium caeruleum] ACF08629.1 PSII low MW protein (chloroplast) [Brachypodium distachyon] ACY66272.1 photosystem II protein M (chloroplast) [Brassica napus] ADD30435.1 photosystem II protein M (chloroplast) [Heuchera sanguinea] ADO15397.1 photosystem II protein M (chloroplast) [Jacobaea vulgaris] ADW94825.1 PsbM (plastid) [Streptocarpus montigena] ADW94827.1 PsbM (plastid) [Streptocarpus montigena] ADW94829.1 PsbM (plastid) [Streptocarpus montigena] ADW94831.1 PsbM (plastid) [Streptocarpus montigena] AEX99264.1 PsbM (chloroplast) [Chrysanthemum indicum] AEX99500.1 photosystem II M protein (chloroplast) [Chrysanthemum indicum] AFA26834.1 photosystem II protein M (plastid) [Abolboda macrostachya] AFA26848.1 photosystem II protein M, partial (plastid) [Flagellaria indica] AFA45260.1 photosystem II M protein (chloroplast) [Chrysanthemum x morifolium] AFP98807.1 photosystem II reaction center M protein (chloroplast) [Artemisia frigida] AFQ99056.1 photosystem II protein M (chloroplast) [Sedum sarmentosum] AGQ50345.1 photosystem II protein M (chloroplast) [Rumex acetosa] AGW97095.1 photosystem II protein M (chloroplast) [Ipomoea dumetorum] BAO01486.1 photosystem II protein M (chloroplast) [Vitis vinifera subsp. caucasica] BAO01570.1 photosystem II protein M (chloroplast) [Vitis vinifera subsp. caucasica] BAO01654.1 photosystem II protein M (chloroplast) [Vitis vinifera subsp. caucasica] AGZ13345.1 photosystem II protein M (chloroplast) [Haloxylon ammodendron] AGZ13430.1 photosystem II protein M (chloroplast) [Haloxylon persicum] AGZ17919.1 photosystem II protein M (chloroplast) [Agrostemma githago] CCW28173.1 psbM protein (chloroplast) [Arabis alpina] AHJ61131.1 photosystem II reaction center M protein (chloroplast) [Artemisia montana] AHJ91203.1 photosystem II protein M (chloroplast) [Vitis rotundifolia] AHX80445.1 photosystem II protein M (plastid) [Paris verticillata] AHY80535.1 photosystem II protein M (plastid) [Beta vulgaris subsp. vulgaris] AHY94446.1 photosystem II reaction center M protein (chloroplast) [Hanabusaya asiatica] AHZ43052.1 photosystem II protein M (chloroplast) [Goodyera fumata] AIE42460.1 photosystem II protein M (chloroplast) [Raphanus sativus] AIK28998.1 photosystem II protein M (chloroplast) [Brassica napus] AIM53772.1 photosystem II protein M (plastid) [Zizania aquatica] AIN75577.1 photosystem II protein M (chloroplast) [Campanula americana] AIS35677.1 photosystem II protein M (chloroplast) [Mesembryanthemum crystallinum] AIZ06074.1 photosystem II protein M (chloroplast) [Brassica napus] AIZ76886.1 photosystem II protein M (chloroplast) [Zizania latifolia] AJB98614.1 PsbM (chloroplast) [Artemisia argyi] AJD00854.1 photosystem II reaction center M protein (chloroplast) [Campanula takesimana] AJE74527.1 photosystem II protein M (plastid) [Lactuca ludoviciana] AJE74983.1 photosystem II protein M (plastid) [Achillea millefolium] AJE75211.1 photosystem II protein M (plastid) [Senecio integerrimus] AJV88505.1 photosystem II protein M (chloroplast) [Campynema lineare] AKD00083.1 photosystem II protein M (plastid) [Brassica napus] AKE32206.1 photosystem II reaction center M protein (chloroplast) [Adenophora remotiflora] AKH59826.1 photosystem II protein M (plastid) [Trillium cuneatum] AKJ83675.1 photosystem II protein M (chloroplast) [Spathiphyllum kochii] AKM97912.1 PsbM (chloroplast) [Brassica oleracea var. capitata] AKP95045.1 photosystem II protein M (chloroplast) [Anoectochilus roxburghii] AKU36903.1 photosystem II protein M (plastid) [Trillium maculatum] AKU36984.1 photosystem II protein M (plastid) [Trillium tschonoskii] AKZ23259.1 photosystem II protein M (plastid) [Ellisia nyctelea] AKZ23278.1 photosystem II protein M (plastid) [Impatiens capensis] AKZ23279.1 photosystem II protein M (plastid) [Comandra umbellata] AKZ23283.1 photosystem II protein M (plastid) [Campanula rotundifolia] ALB78414.1 photosystem II protein M (chloroplast) [Heuchera parviflora var. saurensis] ALC75177.1 photosystem II protein M (chloroplast) [Osyris alba] ALE65914.1 photosystem II protein M (chloroplast) [Pericallis hybrida] ALG63283.1 photosystem II protein M (chloroplast) [Beta vulgaris subsp. vulgaris] ALI30850.1 photosystem II protein M (plastid) [Brighamia insignis] ALK26677.1 photosystem II protein M (chloroplast) [Brassica juncea] ALL45464.1 PSII low MW protein (chloroplast) [Isatis tinctoria] ALO71256.1 photosystem II protein M (chloroplast) [Ampelopsis glandulosa var. brevipedunculata] ALP73112.1 photosystem II protein M (chloroplast) [Schrenkiella parvula] CRN13133.1 photosystem II protein M (chloroplast) [Cochlearia borzaeana] CRN13216.1 photosystem II protein M (chloroplast) [Cochlearia islandica] CRN13299.1 photosystem II protein M (chloroplast) [Cochlearia pyrenaica] CRN13382.1 photosystem II protein M (chloroplast) [Cochlearia tridactylites] CRN13465.1 photosystem II protein M (chloroplast) [Ionopsidium acaule] ALV89919.1 photosystem II protein M (chloroplast) [Tetrastigma hemsleyanum] AMA07283.1 photosystem II protein M (chloroplast) [Goodyera velutina] AMB27128.1 photosystem II protein M (chloroplast) [Zizania latifolia] AMD08694.1 photosystem II protein M (chloroplast) [Papaver somniferum] AMD12011.1 photosystem II protein M (chloroplast) [Vitis aestivalis] AML80544.1 photosystem II protein M (chloroplast) [Pedicularis ishidoyana] AMR74021.1 photosystem II reaction center M protein (plastid) [Campanula punctata] AMX21810.1 psbM (mitochondrion) [Dendrosenecio brassiciformis] ANA07410.1 photosystem II protein M (chloroplast) [Coffea canephora] AND76554.1 photosystem II protein M (chloroplast) [Daiswa yunnanensis] ANE10904.1 PsbM (chloroplast) [Brassica nigra] ANJ04036.1 photosystem II protein M (chloroplast) [Pugionium dolabratum] ANJ04121.1 photosystem II protein M (chloroplast) [Pugionium cornutum] ANN38926.1 PsbM (chloroplast) [Hydrangea serrata f. fertilis] ANO44591.1 photosystem II protein M (chloroplast) [Amianthium muscitoxicum] ANO44713.1 photosystem II protein M (chloroplast) [Calochortus albus] ANO45128.1 photosystem II protein M (chloroplast) [Campynemanthe viridiflora] ANO45422.1 photosystem II protein M (chloroplast) [Trillium luteum] ANS11243.1 PsbM (chloroplast) [Artemisia fukudo] ANS57980.1 PsbM (chloroplast) [Ligularia fischeri] ANT45662.1 photosystem II protein M (chloroplast) [Isatis tinctoria] ANW47862.1 PsbM (chloroplast) [Taraxacum officinale] ANW83271.1 PsbM (plastid) [Brassica napus var. napus] ANW83358.1 PsbM (plastid) [Brassica napus var. napus] ANW83444.1 PsbM (plastid) [Brassica napus var. napus] ANW83529.1 PsbM (plastid) [Brassica napus var. napus] ANW83615.1 PsbM (plastid) [Brassica napus var. napus] ANW83703.1 PsbM (plastid) [Brassica napus var. napus] ANW83789.1 PsbM (plastid) [Brassica napus var. napus] ANW83875.1 PsbM (plastid) [Brassica napus var. napus] ANW83961.1 PsbM (plastid) [Brassica napus var. napus] ANX10040.1 photosystem II protein M (chloroplast) [Cakile arabica] ANX10295.1 photosystem II protein M (chloroplast) [Striga hermonthica] AOG66067.1 photosystem II M protein (chloroplast) [Swertia mussotii] AOP04292.1 photosystem II protein M (chloroplast) [Gentiana lawrencei var. farreri] AOR52764.1 photosystem II protein M (chloroplast) [Vitis amurensis] AOR82212.1 PsbM (chloroplast) [Taraxacum platycarpum] AOR82299.1 PsbM (chloroplast) [Taraxacum mongolicum] AOR82572.1 PsbM (chloroplast) [Artemisia gmelinii] AOR82660.1 PsbM (chloroplast) [Artemisia capillaris] AOV93787.1 photosystem II protein M (chloroplast) [Taraxacum sp. RHS-2016] AOV93872.1 photosystem II protein M (chloroplast) [Taraxacum obtusifrons] AOV93956.1 photosystem II protein M (chloroplast) [Taraxacum amplum] APA33598.1 photosystem II protein M (chloroplast) [Taraxacum brevicorniculatum] APA33680.1 photosystem II protein M (chloroplast) [Taraxacum kok-saghyz] APA33762.1 photosystem II protein M (chloroplast) [Taraxacum officinale] APD26336.1 photosystem II protein M (chloroplast) [Oxyria sinensis] APO08520.1 photosystem II protein M (chloroplast) [Orychophragmus violaceus] APQ38732.1 photosystem II protein M (plastid) [Cyanea fissa] APQ38822.1 photosystem II protein M (plastid) [Delissea rhytidosperma] APQ38912.1 photosystem II protein M (plastid) [Lithotoma petraea] APQ38991.1 photosystem II protein M (plastid) [Lobelia anceps] APQ39088.1 photosystem II protein M (plastid) [Lobelia boninensis] APQ39178.1 photosystem II protein M (plastid) [Lobelia gregoriana subsp. sattimae] APQ39268.1 photosystem II protein M (plastid) [Lobelia inflata] APQ39357.1 photosystem II protein M (plastid) [Lobelia jasionoides] APQ39447.1 photosystem II protein M (plastid) [Lobelia laxiflora] APQ39536.1 photosystem II protein M (plastid) [Lobelia longisepala] APQ39624.1 photosystem II protein M (plastid) [Lobelia morogoroensis] APQ39713.1 photosystem II protein M (plastid) [Lobelia polyphylla] APQ39803.1 photosystem II protein M (plastid) [Lobelia siphilitica var. siphilitica] APQ39893.1 photosystem II protein M (plastid) [Lobelia stricklandiae] APQ39983.1 photosystem II protein M (plastid) [Lobelia thuliniana] APQ40135.1 photosystem II protein M (plastid) [Wimmerella hederacea] APS85075.1 photosystem II protein M (chloroplast) [Orychophragmus sp. HH-2017b] APS85160.1 photosystem II protein M (chloroplast) [Orychophragmus diffusus] APS85245.1 photosystem II protein M (chloroplast) [Orychophragmus sp. HH-2017a] APS85330.1 photosystem II protein M (chloroplast) [Orychophragmus taibaiensis] APS85415.1 photosystem II protein M (chloroplast) [Orychophragmus hupehensis] APS87339.1 photosystem II protein M (chloroplast) [Paris cronquistii] APS87423.1 photosystem II protein M (chloroplast) [Daiswa dunniana] APS87505.1 photosystem II protein M (chloroplast) [Daiswa forrestii] APS87591.1 photosystem II protein M (chloroplast) [Daiswa forrestii] APS87675.1 photosystem II protein M (chloroplast) [Paris luquanensis] APS87759.1 photosystem II protein M (chloroplast) [Paris mairei] APS87843.1 photosystem II protein M (chloroplast) [Paris marmorata] APS88011.1 photosystem II protein M (chloroplast) [Daiswa yunnanensis] APS88095.1 photosystem II protein M (chloroplast) [Paris vietnamensis] APS88181.1 photosystem II protein M (chloroplast) [Paris quadrifolia] BAW81307.1 photosystem II protein M (chloroplast) [Anoectochilus emeiensis] Length = 34 Score = 66.6 bits (161), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 312 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 34 >YP_009145255.1 photosystem II protein M (plastid) [Trillium decumbens] AKK32133.1 photosystem II protein M (plastid) [Trillium decumbens] Length = 37 Score = 66.6 bits (161), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 312 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 34 >YP_009262745.1 photosystem II protein M (chloroplast) [Ludisia discolor] ANI87410.1 photosystem II protein M (chloroplast) [Ludisia discolor] Length = 34 Score = 66.2 bits (160), Expect = 1e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 312 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 ME+NILAFIATALFILVPTAFLLIIYVKTVSQNN Sbjct: 1 MEINILAFIATALFILVPTAFLLIIYVKTVSQNN 34 >YP_009154945.1 photosystem II M protein (chloroplast) [Gentiana straminea] YP_009155030.1 photosystem II M protein (chloroplast) [Gentiana crassicaulis] YP_009155860.1 photosystem II protein M (plastid) [Stipa hymenoides] YP_009156028.1 photosystem II protein M (plastid) [Ampelodesmos mauritanicus] YP_009157112.1 photosystem II protein M (plastid) [Oryzopsis asperifolia] YP_009157363.1 photosystem II protein M (plastid) [Phleum alpinum] YP_009157447.1 photosystem II protein M (plastid) [Piptochaetium avenaceum] YP_009175669.1 photosystem II protein M (chloroplast) [Eutrema salsugineum] YP_009180558.1 photosystem II protein M (chloroplast) [Stipa lipskyi] YP_009192782.1 photosystem II protein M (chloroplast) [Eutrema yunnanense] YP_009192869.1 photosystem II protein M (chloroplast) [Eutrema heterophyllum] YP_009232350.1 photosystem II protein M (chloroplast) [Eutrema halophilum] YP_009232437.1 photosystem II protein M (chloroplast) [Eutrema botschantzevii] YP_009232648.1 photosystem II protein M (chloroplast) [Stipa purpurea] YP_009256989.1 photosystem II protein M (chloroplast) [Gentiana tibetica] YP_009330685.1 photosystem II protein M (chloroplast) [Viburnum utile] AID57319.1 photosystem II M protein (chloroplast) [Gentiana straminea] AID61129.1 photosystem II M protein (chloroplast) [Gentiana crassicaulis] AJV88767.1 photosystem II protein M (plastid) [Stipa hymenoides] AJV88935.1 photosystem II protein M (plastid) [Ampelodesmos mauritanicus] AJV90019.1 photosystem II protein M (plastid) [Oryzopsis asperifolia] AJV90270.1 photosystem II protein M (plastid) [Phleum alpinum] AJV90354.1 photosystem II protein M (plastid) [Piptochaetium avenaceum] AKZ31612.1 cytochrome b6/f complex subunit VIII (chloroplast) [Gentiana robusta] ALH16832.1 photosystem II protein M (chloroplast) [Eutrema salsugineum] ALM03049.1 photosystem II protein M (chloroplast) [Stipa lipskyi] ALP73209.1 photosystem II protein M (chloroplast) [Eutrema yunnanense] ALP73286.1 photosystem II protein M (chloroplast) [Eutrema heterophyllum] AMA21337.1 photosystem II protein M (chloroplast) [Eutrema halophilum] AMA21424.1 photosystem II protein M (chloroplast) [Eutrema botschantzevii] AMA97165.1 photosystem II protein M (chloroplast) [Stipa purpurea] AMC31875.1 photosystem II protein M (chloroplast) [Chorispora tenella] ANG07638.1 photosystem II protein M (chloroplast) [Gentiana tibetica] APD79287.1 photosystem II protein M (chloroplast) [Viburnum utile] Length = 34 Score = 66.2 bits (160), Expect = 1e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 312 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 MEVNILAFIATALFIL+PTAFLLIIYVKTVSQNN Sbjct: 1 MEVNILAFIATALFILIPTAFLLIIYVKTVSQNN 34 >YP_009108837.1 photosystem II protein M [Pentalinon luteum] YP_009114229.1 photosystem II reaction center M protein (chloroplast) [Sedum takesimense] YP_009164494.1 PsbM (chloroplast) [Sedum oryzifolium] AHJ61225.1 photosystem II reaction center M protein (chloroplast) [Sedum takesimense] AIW05683.1 photosystem II protein M (plastid) [Pentalinon luteum] AIW05768.1 photosystem II protein M (plastid) [Periploca sepium] AIW05853.1 photosystem II protein M (plastid) [Rhabdadenia biflora] AJD00145.1 PsbM (chloroplast) [Sedum oryzifolium] Length = 34 Score = 66.2 bits (160), Expect = 1e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 312 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 MEVNILAFIATALFILVPTAFLLIIYVKT+SQNN Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTISQNN 34 >YP_009092297.1 photosystem II protein M (chloroplast) [Macadamia integrifolia] AHB38153.1 photosystem II protein M (chloroplast) [Macadamia integrifolia] Length = 34 Score = 66.2 bits (160), Expect = 1e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 312 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 MEVNILAFIATALF+LVPTAFLLIIYVKTVSQNN Sbjct: 1 MEVNILAFIATALFVLVPTAFLLIIYVKTVSQNN 34 >AMC31876.1 photosystem II protein M (chloroplast) [Cleomella serrulata] Length = 37 Score = 66.2 bits (160), Expect = 2e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 312 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 MEVNILAFIATALFIL+PTAFLLIIYVKTVSQNN Sbjct: 1 MEVNILAFIATALFILIPTAFLLIIYVKTVSQNN 34 >ANP95893.1 photosystem II protein M (plastid) [Pyrola rotundifolia] Length = 34 Score = 65.9 bits (159), Expect = 2e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 312 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 MEVNILAF+ATALFILVPTAFLLIIYVKTVSQNN Sbjct: 1 MEVNILAFLATALFILVPTAFLLIIYVKTVSQNN 34 >YP_009169759.1 photosystem II protein M (chloroplast) [Gynochthodes officinalis] ALD61655.1 photosystem II protein M (chloroplast) [Gynochthodes officinalis] Length = 34 Score = 65.5 bits (158), Expect = 3e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 312 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 MEVNILAFIATALFILVPTAFLLIIYVKTVS+NN Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSENN 34 >NP_114247.1 photosystem II M protein (chloroplast) [Triticum aestivum] YP_008239081.1 photosystem II protein M (chloroplast) [Triticum monococcum] YP_008239160.1 photosystem II protein M (chloroplast) [Secale cereale] YP_008239237.1 photosystem II protein M (chloroplast) [Triticum urartu] YP_008474288.1 photosystem II protein M (chloroplast) [Aegilops tauschii] YP_008474379.1 photosystem II protein M (chloroplast) [Aegilops speltoides] YP_008963892.1 photosystem II protein M (chloroplast) [Aegilops geniculata] YP_008963815.1 photosystem II protein M (chloroplast) [Aegilops cylindrica] YP_009054824.1 photosystem II protein M (chloroplast) [Triticum timopheevii] YP_009057916.1 photosystem II protein M (chloroplast) [Aegilops longissima] YP_009057998.1 photosystem II protein M (chloroplast) [Aegilops bicornis] YP_009057387.1 photosystem II protein M (chloroplast) [Aegilops sharonensis] YP_009057305.1 photosystem II protein M (chloroplast) [Aegilops searsii] YP_009058080.1 photosystem II protein M (chloroplast) [Aegilops kotschyi] YP_009057223.1 photosystem II protein M (chloroplast) [Triticum turgidum] YP_009112454.1 photosystem II protein M (chloroplast) [Triticum macha] Q9XPS6.1 RecName: Full=Photosystem II reaction center protein M; Short=PSII-M BAA78038.1 PSII M-protein (chloroplast) [Triticum aestivum] BAB47022.1 PSII low MW protein (chloroplast) [Triticum aestivum] AFH89497.1 photosystem II protein M (chloroplast) [Aegilops tauschii] AFN42361.1 photosystem II protein M (chloroplast) [Aegilops speltoides] AGP50978.1 photosystem II protein M (chloroplast) [Triticum monococcum] AGP51057.1 photosystem II protein M (chloroplast) [Secale cereale] AGP51134.1 photosystem II protein M (chloroplast) [Triticum monococcum subsp. aegilopoides] AGP51211.1 photosystem II protein M (chloroplast) [Triticum urartu] AGP51271.1 photosystem II protein M (chloroplast) [Triticum aestivum] AGY92845.1 photosystem II protein M (chloroplast) [Aegilops cylindrica] AGY92922.1 photosystem II protein M (chloroplast) [Aegilops geniculata] AHN16241.1 photosystem II protein M (chloroplast) [Triticum urartu] AIG61157.1 photosystem II protein M (chloroplast) [Triticum aestivum] AIG90416.1 photosystem II protein M (chloroplast) [Triticum aestivum] AIG90498.1 photosystem II protein M (chloroplast) [Triticum turgidum] AIG90580.1 photosystem II protein M (chloroplast) [Triticum turgidum] AIG90662.1 photosystem II protein M (chloroplast) [Triticum turgidum] AIG90744.1 photosystem II protein M (chloroplast) [Triticum turgidum] AIG90826.1 photosystem II protein M (chloroplast) [Triticum turgidum] AIG90908.1 photosystem II protein M (chloroplast) [Triticum turgidum] AIG90990.1 photosystem II protein M (chloroplast) [Triticum aestivum] AIG91072.1 photosystem II protein M (chloroplast) [Aegilops speltoides var. ligustica] AIG91154.1 photosystem II protein M (chloroplast) [Aegilops speltoides var. ligustica] AIG91236.1 photosystem II protein M (chloroplast) [Aegilops speltoides var. speltoides] AIG91318.1 photosystem II protein M (chloroplast) [Triticum timopheevii] AIG91400.1 photosystem II protein M (chloroplast) [Triticum timopheevii] AIG91482.1 photosystem II protein M (chloroplast) [Triticum timopheevii] AIG91564.1 photosystem II protein M (chloroplast) [Triticum timopheevii] AIG91646.1 photosystem II protein M (chloroplast) [Triticum urartu] AIG91728.1 photosystem II protein M (chloroplast) [Aegilops tauschii] AIG91810.1 photosystem II protein M (chloroplast) [Aegilops searsii] AIG91892.1 photosystem II protein M (chloroplast) [Aegilops searsii] AIG91974.1 photosystem II protein M (chloroplast) [Aegilops searsii] AIG92056.1 photosystem II protein M (chloroplast) [Aegilops longissima] AIG92138.1 photosystem II protein M (chloroplast) [Aegilops sharonensis] AIG92220.1 photosystem II protein M (chloroplast) [Aegilops bicornis] AIG92302.1 photosystem II protein M (chloroplast) [Aegilops sharonensis] AIG92384.1 photosystem II protein M (chloroplast) [Aegilops kotschyi] BAP59024.1 photosystem II protein M, partial (chloroplast) [Triticum timopheevii] AIU45446.1 photosystem II protein M (chloroplast) [Triticum turgidum subsp. durum] BAP90868.1 photosystem II protein M (chloroplast) [Triticum monococcum subsp. monococcum] BAP91057.1 photosystem II protein M (chloroplast) [Triticum macha] Length = 34 Score = 65.5 bits (158), Expect = 3e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 312 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 MEVNILAFIATALFILVPT+FLLIIYVKTVSQNN Sbjct: 1 MEVNILAFIATALFILVPTSFLLIIYVKTVSQNN 34 >ANO44774.1 photosystem II protein M (chloroplast) [Clintonia borealis] ANO44896.1 photosystem II protein M (chloroplast) [Tulipa pulchella] ANO45302.1 photosystem II protein M (chloroplast) [Medeola virginiana] Length = 34 Score = 65.1 bits (157), Expect = 4e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 312 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 MEVNILAFIATALFILVPTAFLLIIYVKT SQNN Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTASQNN 34 >YP_009054213.1 photosystem II protein M (chloroplast) [Fritillaria hupehensis] AHE79764.1 photosystem II protein M (chloroplast) [Fritillaria hupehensis] Length = 34 Score = 65.1 bits (157), Expect = 4e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 312 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 MEVNILAFIAT LFILVPTAFLLIIYVKTVSQNN Sbjct: 1 MEVNILAFIATTLFILVPTAFLLIIYVKTVSQNN 34 >YP_002608408.1 PSII M protein [Vitis vinifera] CAQ77678.1 PSII M protein (mitochondrion) [Vitis vinifera] ACS15200.1 PSII M protein (mitochondrion) [Vitis vinifera] Length = 34 Score = 65.1 bits (157), Expect = 4e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 312 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 MEVNILAFIATALFILVPTAFL IIYVKTVSQNN Sbjct: 1 MEVNILAFIATALFILVPTAFLFIIYVKTVSQNN 34 >YP_874641.1 photosystem II protein M (chloroplast) [Hordeum vulgare subsp. vulgare] YP_009156864.1 photosystem II protein M (plastid) [Hordeum jubatum] A1E9H9.1 RecName: Full=Photosystem II reaction center protein M; Short=PSII-M ABK79401.1 photosystem II protein M (chloroplast) [Hordeum vulgare subsp. vulgare] AGP50743.1 photosystem II protein M (chloroplast) [Hordeum vulgare subsp. vulgare] AGP50819.1 photosystem II protein M (chloroplast) [Hordeum vulgare subsp. spontaneum] AGP50899.1 photosystem II protein M (chloroplast) [Hordeum vulgare subsp. spontaneum] AJV89771.1 photosystem II protein M (plastid) [Hordeum jubatum] AMA20234.1 photosystem II protein M (chloroplast) [Hordeum vulgare subsp. vulgare] Length = 34 Score = 65.1 bits (157), Expect = 4e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 312 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 211 MEVNILAFIATALFIL+PT+FLLIIYVKTVSQNN Sbjct: 1 MEVNILAFIATALFILIPTSFLLIIYVKTVSQNN 34