BLASTX nr result
ID: Lithospermum23_contig00018384
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00018384 (230 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP07691.1 unnamed protein product [Coffea canephora] 52 8e-06 >CDP07691.1 unnamed protein product [Coffea canephora] Length = 438 Score = 51.6 bits (122), Expect = 8e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +3 Query: 135 IQIQYPSSGPSGRGQLGNRVSSGAFASEPAEA 230 +++QYP SGP+GR Q GNRVSSG ASEPAEA Sbjct: 212 MKMQYPPSGPTGRSQFGNRVSSGGHASEPAEA 243