BLASTX nr result
ID: Lithospermum23_contig00018381
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00018381 (1527 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAC08401.1 auxin-induced protein, partial [Mesembryanthemum crys... 65 2e-09 AFK42432.1 unknown [Lotus japonicus] AFK45903.1 unknown [Lotus j... 62 2e-08 KGN54862.1 SAUR family protein [Cucumis sativus] 62 3e-08 KNA03681.1 hypothetical protein SOVF_206780 [Spinacia oleracea] 62 3e-08 KDO58700.1 hypothetical protein CISIN_1g034194mg [Citrus sinensis] 60 8e-08 XP_010025710.2 PREDICTED: auxin-induced protein 6B-like [Eucalyp... 60 8e-08 XP_010272893.1 PREDICTED: auxin-induced protein 6B-like [Nelumbo... 60 1e-07 XP_006426444.1 hypothetical protein CICLE_v10026768mg [Citrus cl... 60 1e-07 XP_014524491.1 PREDICTED: auxin-induced protein 6B-like [Vigna r... 60 2e-07 NP_001236763.1 uncharacterized protein LOC100306049 [Glycine max... 60 2e-07 EYU20641.1 hypothetical protein MIMGU_mgv1a025587mg [Erythranthe... 59 2e-07 XP_020090820.1 auxin-responsive protein SAUR32-like [Ananas como... 59 3e-07 OAY71925.1 Auxin-responsive protein SAUR32 [Ananas comosus] 59 3e-07 XP_003532148.1 PREDICTED: auxin-responsive protein SAUR32-like [... 59 3e-07 XP_006578762.1 PREDICTED: auxin-induced protein 6B-like [Glycine... 59 4e-07 XP_009410173.1 PREDICTED: auxin-responsive protein SAUR32-like [... 58 4e-07 XP_002300214.1 hypothetical protein POPTR_0001s31380g [Populus t... 58 6e-07 NP_001236702.1 uncharacterized protein LOC100306557 [Glycine max... 58 7e-07 XP_018808507.1 PREDICTED: auxin-induced protein 6B-like [Juglans... 58 7e-07 XP_017421346.1 PREDICTED: auxin-induced protein 6B-like [Vigna a... 58 8e-07 >AAC08401.1 auxin-induced protein, partial [Mesembryanthemum crystallinum] Length = 85 Score = 64.7 bits (156), Expect = 2e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERERST 110 KAREVYGY +GPL+LPC VDDFLDLRW+IERE S+ Sbjct: 49 KAREVYGYHADGPLKLPCSVDDFLDLRWRIERENSS 84 >AFK42432.1 unknown [Lotus japonicus] AFK45903.1 unknown [Lotus japonicus] Length = 97 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERERSTSSSRN 125 +AREVYGY GPL+LPC +DDFL LRWQIE+E S S N Sbjct: 43 RAREVYGYHTEGPLKLPCSLDDFLHLRWQIEKESSNSHHNN 83 >KGN54862.1 SAUR family protein [Cucumis sativus] Length = 113 Score = 62.0 bits (149), Expect = 3e-08 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERE 101 KA+E+YGY NGPLRLPC VDDFL LRWQIE+E Sbjct: 48 KAQEIYGYHANGPLRLPCSVDDFLQLRWQIEKE 80 >KNA03681.1 hypothetical protein SOVF_206780 [Spinacia oleracea] Length = 101 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERERS 107 KAREVYGY +GPL+LPC VDDFLDL+W+IE+E S Sbjct: 41 KAREVYGYYSDGPLKLPCSVDDFLDLKWRIEKESS 75 >KDO58700.1 hypothetical protein CISIN_1g034194mg [Citrus sinensis] Length = 101 Score = 60.5 bits (145), Expect = 8e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERERST 110 KAREVYGY +GPLRLPC VDDFL L+W+IERE ++ Sbjct: 49 KAREVYGYNTDGPLRLPCSVDDFLHLQWRIERESNS 84 >XP_010025710.2 PREDICTED: auxin-induced protein 6B-like [Eucalyptus grandis] Length = 103 Score = 60.5 bits (145), Expect = 8e-08 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERERSTS 113 KA E YGY NGPLRLPC VDDFL LRW+IE+E S S Sbjct: 42 KAHEAYGYHANGPLRLPCSVDDFLHLRWRIEKESSGS 78 >XP_010272893.1 PREDICTED: auxin-induced protein 6B-like [Nelumbo nucifera] Length = 113 Score = 60.1 bits (144), Expect = 1e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERERST 110 KA+EVYGY GPLRLPC VDDFL LRW+IERE ++ Sbjct: 63 KAQEVYGYHSTGPLRLPCSVDDFLHLRWRIERESNS 98 >XP_006426444.1 hypothetical protein CICLE_v10026768mg [Citrus clementina] ESR39684.1 hypothetical protein CICLE_v10026768mg [Citrus clementina] Length = 128 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERERST 110 KAREVYGY +GPLRLPC VDDFL L+W+IERE ++ Sbjct: 76 KAREVYGYNTDGPLRLPCSVDDFLHLQWRIERESNS 111 >XP_014524491.1 PREDICTED: auxin-induced protein 6B-like [Vigna radiata var. radiata] Length = 107 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERERSTSSSRN 125 KAREVYGY +GPL+LPC VDDFL LRW+IE+E STS + Sbjct: 51 KAREVYGYHTDGPLKLPCSVDDFLHLRWRIEKE-STSDQHH 90 >NP_001236763.1 uncharacterized protein LOC100306049 [Glycine max] ACU14040.1 unknown [Glycine max] KRH53979.1 hypothetical protein GLYMA_06G158700 [Glycine max] Length = 107 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERERSTSSSRN 125 KAREVYGY +GPL+LPC VDDFL LRW+IE+E + + + + Sbjct: 51 KAREVYGYHTDGPLKLPCSVDDFLHLRWRIEKESAPNQNHH 91 >EYU20641.1 hypothetical protein MIMGU_mgv1a025587mg [Erythranthe guttata] Length = 99 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERE 101 KARE+YGY GPLRLPC V+DFL LRW+IERE Sbjct: 44 KAREIYGYNATGPLRLPCSVEDFLHLRWRIERE 76 >XP_020090820.1 auxin-responsive protein SAUR32-like [Ananas comosus] Length = 102 Score = 58.9 bits (141), Expect = 3e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +3 Query: 6 AREVYGYKKNGPLRLPCLVDDFLDLRWQIERERSTSSS 119 A+EVYGY +GP++LPC VD+FL LRW IERE +SSS Sbjct: 49 AKEVYGYSSSGPIKLPCSVDEFLHLRWLIERESQSSSS 86 >OAY71925.1 Auxin-responsive protein SAUR32 [Ananas comosus] Length = 102 Score = 58.9 bits (141), Expect = 3e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +3 Query: 6 AREVYGYKKNGPLRLPCLVDDFLDLRWQIERERSTSSS 119 A+EVYGY +GP++LPC VD+FL LRW IERE +SSS Sbjct: 49 AKEVYGYSSSGPIKLPCSVDEFLHLRWLIERESQSSSS 86 >XP_003532148.1 PREDICTED: auxin-responsive protein SAUR32-like [Glycine max] KHN16921.1 Auxin-induced protein 6B [Glycine soja] KRH40994.1 hypothetical protein GLYMA_08G004100 [Glycine max] Length = 105 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERERSTSSSRN 125 KA EVYGY GPL+LPC VDDFL LRW+I++E ST N Sbjct: 45 KAYEVYGYHTEGPLKLPCSVDDFLHLRWRIQKESSTHHHHN 85 >XP_006578762.1 PREDICTED: auxin-induced protein 6B-like [Glycine max] KRH63954.1 hypothetical protein GLYMA_04G206800 [Glycine max] Length = 107 Score = 58.5 bits (140), Expect = 4e-07 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERERSTSSSRN 125 KAREVYGY +GPL+LPC VDDFL LRW+I++E + + + + Sbjct: 51 KAREVYGYHTDGPLKLPCSVDDFLHLRWRIQKESTPNQNHH 91 >XP_009410173.1 PREDICTED: auxin-responsive protein SAUR32-like [Musa acuminata subsp. malaccensis] Length = 97 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 6 AREVYGYKKNGPLRLPCLVDDFLDLRWQIERERSTSSS 119 AREVYG++ +GPL+LPC VDDFL LRW IERE S S Sbjct: 49 AREVYGFRSSGPLKLPCSVDDFLHLRWLIERESHHSHS 86 >XP_002300214.1 hypothetical protein POPTR_0001s31380g [Populus trichocarpa] EEE85019.1 hypothetical protein POPTR_0001s31380g [Populus trichocarpa] Length = 106 Score = 58.2 bits (139), Expect = 6e-07 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERERSTSS 116 KA EVYGY GPLR+PC VDDFL LRW+IE+E S S Sbjct: 51 KAHEVYGYHTTGPLRVPCSVDDFLHLRWRIEKESSHHS 88 >NP_001236702.1 uncharacterized protein LOC100306557 [Glycine max] ACU14780.1 unknown [Glycine max] KHN17415.1 Auxin-induced protein 6B [Glycine soja] KRH59646.1 hypothetical protein GLYMA_05G196300 [Glycine max] Length = 101 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERERST 110 KA EVYGY GPL+LPC VDDFL LRW+IE+E +T Sbjct: 42 KAYEVYGYHTEGPLKLPCSVDDFLHLRWRIEKESTT 77 >XP_018808507.1 PREDICTED: auxin-induced protein 6B-like [Juglans regia] Length = 103 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERE 101 KA EVYGY GPLRLPC VDDFL LRW+IE+E Sbjct: 48 KAHEVYGYHTTGPLRLPCSVDDFLHLRWRIEKE 80 >XP_017421346.1 PREDICTED: auxin-induced protein 6B-like [Vigna angularis] KOM41214.1 hypothetical protein LR48_Vigan04g141200 [Vigna angularis] BAT79255.1 hypothetical protein VIGAN_02210600 [Vigna angularis var. angularis] Length = 107 Score = 57.8 bits (138), Expect = 8e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 3 KAREVYGYKKNGPLRLPCLVDDFLDLRWQIERERSTSSSRN 125 KA EVYGY +GPL+LPC VDDFL LRW+IE+E STS + Sbjct: 51 KAHEVYGYHTDGPLKLPCSVDDFLHLRWRIEKE-STSDQHH 90