BLASTX nr result
ID: Lithospermum23_contig00018352
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00018352 (380 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011096354.1 PREDICTED: protein E6-like [Sesamum indicum] 54 6e-06 >XP_011096354.1 PREDICTED: protein E6-like [Sesamum indicum] Length = 302 Score = 53.9 bits (128), Expect = 6e-06 Identities = 25/45 (55%), Positives = 31/45 (68%), Gaps = 2/45 (4%) Frame = -3 Query: 378 GMSDTRLMENGKYNYDINSGTYNRDHPY--VNTMAMRNRYNPTEY 250 GMSDTR + NGKY YDIN+G Y+R+HPY + + RN YN Y Sbjct: 222 GMSDTRSVGNGKYYYDINTGRYSRNHPYESLRGVGARNAYNNRNY 266