BLASTX nr result
ID: Lithospermum23_contig00018309
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00018309 (306 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016559855.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 5e-07 XP_019152180.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 3e-06 >XP_016559855.1 PREDICTED: pentatricopeptide repeat-containing protein At1g71490-like [Capsicum annuum] XP_016559856.1 PREDICTED: pentatricopeptide repeat-containing protein At1g71490-like [Capsicum annuum] XP_016559857.1 PREDICTED: pentatricopeptide repeat-containing protein At1g71490-like [Capsicum annuum] Length = 738 Score = 56.2 bits (134), Expect = 5e-07 Identities = 34/81 (41%), Positives = 45/81 (55%), Gaps = 21/81 (25%) Frame = -2 Query: 185 MPSYHSL-PKGISLRLLEKFIPKKWKLKVDR--------------------VNDEYESMV 69 MPS S+ P+ +SL L++KFIPK+W+ + N ESMV Sbjct: 1 MPSPFSVQPRNLSLSLIQKFIPKEWRSVRESDPRNCGQSVPCSSHECISGPCNARNESMV 60 Query: 68 NCLLTILKDFVSQGNLVKAFR 6 +CLLT LKDFV QG++ KAFR Sbjct: 61 DCLLTTLKDFVGQGHICKAFR 81 >XP_019152180.1 PREDICTED: pentatricopeptide repeat-containing protein At1g71490 [Ipomoea nil] XP_019152181.1 PREDICTED: pentatricopeptide repeat-containing protein At1g71490 [Ipomoea nil] Length = 734 Score = 53.9 bits (128), Expect = 3e-06 Identities = 34/75 (45%), Positives = 41/75 (54%), Gaps = 21/75 (28%) Frame = -2 Query: 167 LPKGISLRLLEKFIPKKWK--LKVDRVNDEYES-------------------MVNCLLTI 51 LPK SL +EKFIPKKWK +KV + + ES MV+CLL Sbjct: 8 LPKNFSLFQVEKFIPKKWKQSVKVSDIQNNIESFVSSSHELIVGTHMPYDESMVDCLLLT 67 Query: 50 LKDFVSQGNLVKAFR 6 LK+FVSQG+L KA R Sbjct: 68 LKNFVSQGHLAKAVR 82