BLASTX nr result
ID: Lithospermum23_contig00018111
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00018111 (410 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDO98486.1 unnamed protein product [Coffea canephora] 89 6e-20 XP_016182160.1 PREDICTED: cytochrome c-type biogenesis CcmH-like... 84 7e-18 XP_015946513.1 PREDICTED: cytochrome c-type biogenesis CcmH-like... 84 7e-18 NP_001235607.1 uncharacterized protein LOC100306221 [Glycine max... 84 7e-18 XP_010691380.1 PREDICTED: cytochrome c-type biogenesis CcmH-like... 84 1e-17 XP_009601369.1 PREDICTED: cytochrome c-type biogenesis CcmH-like... 82 2e-17 XP_016480663.1 PREDICTED: cytochrome c-type biogenesis CcmH-like... 82 4e-17 XP_008452301.1 PREDICTED: cytochrome c-type biogenesis CcmH-like... 82 4e-17 XP_004149299.1 PREDICTED: uncharacterized protein LOC101208019 [... 82 4e-17 KNA22454.1 hypothetical protein SOVF_033340 [Spinacia oleracea] 82 4e-17 XP_006444153.1 hypothetical protein CICLE_v10022630mg [Citrus cl... 82 4e-17 XP_015068084.1 PREDICTED: cytochrome c-type biogenesis CcmH-like... 79 5e-17 XP_009338060.1 PREDICTED: cytochrome c-type biogenesis CcmH-like... 81 1e-16 XP_009338047.1 PREDICTED: cytochrome c-type biogenesis CcmH-like... 81 1e-16 XP_019443462.1 PREDICTED: cytochrome c-type biogenesis CcmH-like... 81 1e-16 XP_002516012.1 PREDICTED: cytochrome c-type biogenesis CcmH-like... 81 1e-16 XP_017437897.1 PREDICTED: cytochrome c-type biogenesis CcmH-like... 80 1e-16 BAU02234.1 hypothetical protein VIGAN_11171700 [Vigna angularis ... 80 1e-16 XP_007135669.1 hypothetical protein PHAVU_010G148400g [Phaseolus... 80 1e-16 XP_012073382.1 PREDICTED: uncharacterized protein LOC105635014 [... 80 2e-16 >CDO98486.1 unnamed protein product [Coffea canephora] Length = 159 Score = 89.4 bits (220), Expect = 6e-20 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYWWRRFLPR 262 KTNVHIMALNLVRGVPLTPKEKETMLD+LTPPP E SS+WWRR++ R Sbjct: 111 KTNVHIMALNLVRGVPLTPKEKETMLDVLTPPPPEGITSSFWWRRWVGR 159 >XP_016182160.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Arachis ipaensis] Length = 159 Score = 84.0 bits (206), Expect = 7e-18 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYWWRRF 271 KTNVHIMALNLVRG+PLTP+EKETMLD+LTPPPS+ +S WWRR+ Sbjct: 111 KTNVHIMALNLVRGIPLTPREKETMLDVLTPPPSQVARTSSWWRRW 156 >XP_015946513.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Arachis duranensis] Length = 159 Score = 84.0 bits (206), Expect = 7e-18 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYWWRRF 271 KTNVHIMALNLVRG+PLTP+EKETMLD+LTPPPS+ +S WWRR+ Sbjct: 111 KTNVHIMALNLVRGIPLTPREKETMLDVLTPPPSQVARTSSWWRRW 156 >NP_001235607.1 uncharacterized protein LOC100306221 [Glycine max] XP_014633811.1 PREDICTED: uncharacterized protein LOC100306221 isoform X1 [Glycine max] ACU14301.1 unknown [Glycine max] KHN47829.1 Cytochrome c-type biogenesis protein CcmH [Glycine soja] KRH44338.1 hypothetical protein GLYMA_08G204400 [Glycine max] KRH44339.1 hypothetical protein GLYMA_08G204400 [Glycine max] KRH44340.1 hypothetical protein GLYMA_08G204400 [Glycine max] Length = 159 Score = 84.0 bits (206), Expect = 7e-18 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYWWRRFL 268 KTNVHIMALNLVRGVPLTPKEKETMLDILTPP S+ + +WWRR+L Sbjct: 111 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPRSQGVRTPFWWRRWL 157 >XP_010691380.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Beta vulgaris subsp. vulgaris] XP_010691381.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Beta vulgaris subsp. vulgaris] XP_019107637.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Beta vulgaris subsp. vulgaris] KMT00863.1 hypothetical protein BVRB_9g221360 [Beta vulgaris subsp. vulgaris] Length = 159 Score = 83.6 bits (205), Expect = 1e-17 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYWWRR 274 KTNVHIMALNLVRGVPLTPKEKETML++LTPPPS+ SYWW R Sbjct: 111 KTNVHIMALNLVRGVPLTPKEKETMLELLTPPPSQQATPSYWWSR 155 >XP_009601369.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Nicotiana tomentosiformis] Length = 137 Score = 82.0 bits (201), Expect = 2e-17 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYWWRRFL 268 KTNVHIMALNLVRGVPLTPKEKETML++LTPPP T SS WWRR+L Sbjct: 90 KTNVHIMALNLVRGVPLTPKEKETMLEVLTPPPG-GTSSSSWWRRWL 135 >XP_016480663.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Nicotiana tabacum] XP_016480664.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Nicotiana tabacum] XP_016480665.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Nicotiana tabacum] Length = 158 Score = 82.0 bits (201), Expect = 4e-17 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYWWRRFL 268 KTNVHIMALNLVRGVPLTPKEKETML++LTPPP T SS WWRR+L Sbjct: 111 KTNVHIMALNLVRGVPLTPKEKETMLEVLTPPPG-GTSSSSWWRRWL 156 >XP_008452301.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Cucumis melo] XP_008452302.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Cucumis melo] XP_016901245.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Cucumis melo] Length = 158 Score = 82.0 bits (201), Expect = 4e-17 Identities = 37/47 (78%), Positives = 44/47 (93%), Gaps = 2/47 (4%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYW--WRR 274 ++NVHIMALNLVRGVPLTPKEK+TMLD+L+PPPS+ TPSS+W WRR Sbjct: 111 RSNVHIMALNLVRGVPLTPKEKQTMLDLLSPPPSQRTPSSWWRSWRR 157 >XP_004149299.1 PREDICTED: uncharacterized protein LOC101208019 [Cucumis sativus] XP_011650555.1 PREDICTED: uncharacterized protein LOC101208019 [Cucumis sativus] KGN56203.1 hypothetical protein Csa_3G099640 [Cucumis sativus] Length = 158 Score = 82.0 bits (201), Expect = 4e-17 Identities = 37/47 (78%), Positives = 44/47 (93%), Gaps = 2/47 (4%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYW--WRR 274 ++NVHIMALNLVRGVPLTPKEK+TMLD+L+PPPS+ TPSS+W WRR Sbjct: 111 RSNVHIMALNLVRGVPLTPKEKQTMLDLLSPPPSQRTPSSWWRNWRR 157 >KNA22454.1 hypothetical protein SOVF_033340 [Spinacia oleracea] Length = 159 Score = 82.0 bits (201), Expect = 4e-17 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYWWRR 274 KTNVHIMALNLVRGV LTPKEKETML+ILTPPPS+ +SYWW R Sbjct: 111 KTNVHIMALNLVRGVALTPKEKETMLEILTPPPSQRATASYWWSR 155 >XP_006444153.1 hypothetical protein CICLE_v10022630mg [Citrus clementina] XP_006479786.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Citrus sinensis] XP_006479787.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Citrus sinensis] ESR57393.1 hypothetical protein CICLE_v10022630mg [Citrus clementina] KDO38414.1 hypothetical protein CISIN_1g031429mg [Citrus sinensis] KDO38415.1 hypothetical protein CISIN_1g031429mg [Citrus sinensis] Length = 159 Score = 82.0 bits (201), Expect = 4e-17 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYWWRRF 271 KTNVHIMALNLVRGVPLTPKEKETMLD+LTPPP + S WWRR+ Sbjct: 111 KTNVHIMALNLVRGVPLTPKEKETMLDLLTPPPPQRPSPSSWWRRW 156 >XP_015068084.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Solanum pennellii] Length = 76 Score = 79.3 bits (194), Expect = 5e-17 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYWWRRFL 268 KTNVHIMALNLVRG+PLTPKEKETMLD+LTPPP T S WW+R L Sbjct: 29 KTNVHIMALNLVRGIPLTPKEKETMLDVLTPPPG-GTSSLSWWKRLL 74 >XP_009338060.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Pyrus x bretschneideri] Length = 158 Score = 80.9 bits (198), Expect = 1e-16 Identities = 38/46 (82%), Positives = 40/46 (86%), Gaps = 2/46 (4%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYW--WR 277 KTNVHIMALNLVRGVPLTP EK+TMLD+LTPPPS TPSS W WR Sbjct: 111 KTNVHIMALNLVRGVPLTPNEKQTMLDLLTPPPSRGTPSSLWRRWR 156 >XP_009338047.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Pyrus x bretschneideri] XP_009338048.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Pyrus x bretschneideri] Length = 158 Score = 80.9 bits (198), Expect = 1e-16 Identities = 38/46 (82%), Positives = 40/46 (86%), Gaps = 2/46 (4%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYW--WR 277 KTNVHIMALNLVRGVPLTP EK+TMLD+LTPPPS TPSS W WR Sbjct: 111 KTNVHIMALNLVRGVPLTPNEKQTMLDLLTPPPSRGTPSSLWRRWR 156 >XP_019443462.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Lupinus angustifolius] XP_019443463.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Lupinus angustifolius] OIW11889.1 hypothetical protein TanjilG_25802 [Lupinus angustifolius] Length = 159 Score = 80.9 bits (198), Expect = 1e-16 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYWWRRFL 268 KTNVHIMALNLVRGVPLTP+EKETMLDILTPPPS+ +PSS W +R+L Sbjct: 112 KTNVHIMALNLVRGVPLTPREKETMLDILTPPPSQRSPSS-WLKRWL 157 >XP_002516012.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Ricinus communis] EEF46432.1 Cytochrome c-type biogenesis protein cycL precursor, putative [Ricinus communis] Length = 159 Score = 80.9 bits (198), Expect = 1e-16 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYWWRRF 271 KTNVHIMALNLVRGVPLTPKEKETMLDILTPP ++ S WWRR+ Sbjct: 112 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPTTKGATPSSWWRRW 157 >XP_017437897.1 PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Vigna angularis] Length = 155 Score = 80.5 bits (197), Expect = 1e-16 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYWWRR 274 KTNVHIMAL+LVRGV LTPKEKETMLDILTPPPS+ + +WWRR Sbjct: 111 KTNVHIMALDLVRGVSLTPKEKETMLDILTPPPSQGARTPFWWRR 155 >BAU02234.1 hypothetical protein VIGAN_11171700 [Vigna angularis var. angularis] Length = 155 Score = 80.5 bits (197), Expect = 1e-16 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYWWRR 274 KTNVHIMAL+LVRGV LTPKEKETMLDILTPPPS+ + +WWRR Sbjct: 111 KTNVHIMALDLVRGVSLTPKEKETMLDILTPPPSQGARTPFWWRR 155 >XP_007135669.1 hypothetical protein PHAVU_010G148400g [Phaseolus vulgaris] ESW07663.1 hypothetical protein PHAVU_010G148400g [Phaseolus vulgaris] Length = 155 Score = 80.5 bits (197), Expect = 1e-16 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYWWRR 274 KTNVHIMAL+LVRGV LTPKEKETMLDILTPPPS+ + +WWRR Sbjct: 111 KTNVHIMALDLVRGVSLTPKEKETMLDILTPPPSQGARTPFWWRR 155 >XP_012073382.1 PREDICTED: uncharacterized protein LOC105635014 [Jatropha curcas] XP_012073383.1 PREDICTED: uncharacterized protein LOC105635014 [Jatropha curcas] KDP37255.1 hypothetical protein JCGZ_06311 [Jatropha curcas] Length = 158 Score = 80.5 bits (197), Expect = 2e-16 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -3 Query: 408 KTNVHIMALNLVRGVPLTPKEKETMLDILTPPPSEATPSSYWWRRF 271 KTNVHIMALNLVRGVPLTPKEKE ML+ILTPP S A S+WWR++ Sbjct: 111 KTNVHIMALNLVRGVPLTPKEKENMLEILTPPASNAASPSFWWRKW 156