BLASTX nr result
ID: Lithospermum23_contig00017808
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00017808 (364 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN07467.1 hypothetical protein DCAR_008304 [Daucus carota subsp... 82 5e-17 XP_017235353.1 PREDICTED: regulator of nonsense transcripts 1 ho... 82 1e-15 XP_011070275.1 PREDICTED: regulator of nonsense transcripts 1 ho... 81 2e-15 EYU17850.1 hypothetical protein MIMGU_mgv1a000580mg [Erythranthe... 77 5e-14 XP_012829085.1 PREDICTED: regulator of nonsense transcripts 1 ho... 77 5e-14 XP_012842634.1 PREDICTED: regulator of nonsense transcripts 1 ho... 77 5e-14 KZN04760.1 hypothetical protein DCAR_005597 [Daucus carota subsp... 75 2e-13 EPS67765.1 hypothetical protein M569_07005, partial [Genlisea au... 75 2e-13 XP_017235298.1 PREDICTED: regulator of nonsense transcripts 1 ho... 75 2e-13 CDP13413.1 unnamed protein product [Coffea canephora] 75 3e-13 XP_016511699.1 PREDICTED: regulator of nonsense transcripts 1 ho... 74 6e-13 XP_015084953.1 PREDICTED: regulator of nonsense transcripts 1 ho... 74 6e-13 XP_006362492.1 PREDICTED: regulator of nonsense transcripts 1 ho... 74 6e-13 XP_004244550.1 PREDICTED: regulator of nonsense transcripts 1 ho... 74 6e-13 XP_016458238.1 PREDICTED: regulator of nonsense transcripts 1 ho... 74 8e-13 XP_019228759.1 PREDICTED: regulator of nonsense transcripts 1 ho... 71 8e-13 XP_009626110.1 PREDICTED: regulator of nonsense transcripts 1 ho... 74 8e-13 XP_009792531.1 PREDICTED: regulator of nonsense transcripts 1 ho... 74 8e-13 XP_019228197.1 PREDICTED: regulator of nonsense transcripts 1 ho... 74 8e-13 XP_009626103.1 PREDICTED: regulator of nonsense transcripts 1 ho... 74 8e-13 >KZN07467.1 hypothetical protein DCAR_008304 [Daucus carota subsp. sativus] Length = 172 Score = 81.6 bits (200), Expect = 5e-17 Identities = 39/52 (75%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 213 MDS-GTNLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIRDKA 61 MDS NLY+TASQPD G DAYTFLEFNT AD+DDF+YP+F ELSQPIR A Sbjct: 1 MDSQSNNLYDTASQPDIGNDAYTFLEFNTHADDDDFDYPEFHELSQPIRGSA 52 >XP_017235353.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Daucus carota subsp. sativus] Length = 1254 Score = 81.6 bits (200), Expect = 1e-15 Identities = 39/52 (75%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 213 MDS-GTNLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIRDKA 61 MDS NLY+TASQPD G DAYTFLEFNT AD+DDF+YP+F ELSQPIR A Sbjct: 1 MDSQSNNLYDTASQPDIGNDAYTFLEFNTHADDDDFDYPEFHELSQPIRGSA 52 >XP_011070275.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Sesamum indicum] Length = 1276 Score = 81.3 bits (199), Expect = 2e-15 Identities = 42/52 (80%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = -2 Query: 213 MDSGT-NLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIRDKA 61 MDS T NLYETASQPD G DAYTFLEFNTQ DE DF+YP+FQELSQPIR A Sbjct: 1 MDSQTSNLYETASQPDTGNDAYTFLEFNTQGDE-DFDYPEFQELSQPIRSSA 51 >EYU17850.1 hypothetical protein MIMGU_mgv1a000580mg [Erythranthe guttata] Length = 1060 Score = 77.0 bits (188), Expect = 5e-14 Identities = 39/49 (79%), Positives = 42/49 (85%), Gaps = 1/49 (2%) Frame = -2 Query: 213 MDS-GTNLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIR 70 MDS NLYETASQPD G DAYTFLEFNTQ E+DF+YP+FQELSQPIR Sbjct: 1 MDSQANNLYETASQPDTGNDAYTFLEFNTQG-EEDFDYPEFQELSQPIR 48 >XP_012829085.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Erythranthe guttata] Length = 1081 Score = 77.0 bits (188), Expect = 5e-14 Identities = 39/49 (79%), Positives = 42/49 (85%), Gaps = 1/49 (2%) Frame = -2 Query: 213 MDS-GTNLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIR 70 MDS NLYETASQPD G DAYTFLEFNTQ E+DF+YP+FQELSQPIR Sbjct: 1 MDSQANNLYETASQPDTGNDAYTFLEFNTQG-EEDFDYPEFQELSQPIR 48 >XP_012842634.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Erythranthe guttata] EYU33046.1 hypothetical protein MIMGU_mgv1a000320mg [Erythranthe guttata] Length = 1260 Score = 77.0 bits (188), Expect = 5e-14 Identities = 39/49 (79%), Positives = 42/49 (85%), Gaps = 1/49 (2%) Frame = -2 Query: 213 MDS-GTNLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIR 70 MDS NLYETASQPD G DAYTFLEFNTQ E+DF+YP+FQELSQPIR Sbjct: 1 MDSQANNLYETASQPDTGNDAYTFLEFNTQG-EEDFDYPEFQELSQPIR 48 >KZN04760.1 hypothetical protein DCAR_005597 [Daucus carota subsp. sativus] Length = 1221 Score = 75.1 bits (183), Expect = 2e-13 Identities = 38/52 (73%), Positives = 41/52 (78%), Gaps = 1/52 (1%) Frame = -2 Query: 213 MDS-GTNLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIRDKA 61 MDS NL+ETASQPD G DAYTFLEFNT D DDF+YP FQ+LSQPIR A Sbjct: 1 MDSQANNLFETASQPDTGNDAYTFLEFNTHGD-DDFDYPDFQQLSQPIRSSA 51 >EPS67765.1 hypothetical protein M569_07005, partial [Genlisea aurea] Length = 1245 Score = 75.1 bits (183), Expect = 2e-13 Identities = 36/55 (65%), Positives = 43/55 (78%) Frame = -2 Query: 225 ICPIMDSGTNLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIRDKA 61 I P+ ++LYET SQPD G DAYTF+EFNTQ E+DF+YP+FQELSQPIR A Sbjct: 10 ISPMDSQTSDLYETLSQPDTGNDAYTFIEFNTQG-EEDFDYPEFQELSQPIRSAA 63 >XP_017235298.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Daucus carota subsp. sativus] Length = 1248 Score = 75.1 bits (183), Expect = 2e-13 Identities = 38/52 (73%), Positives = 41/52 (78%), Gaps = 1/52 (1%) Frame = -2 Query: 213 MDS-GTNLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIRDKA 61 MDS NL+ETASQPD G DAYTFLEFNT D DDF+YP FQ+LSQPIR A Sbjct: 1 MDSQANNLFETASQPDTGNDAYTFLEFNTHGD-DDFDYPDFQQLSQPIRSSA 51 >CDP13413.1 unnamed protein product [Coffea canephora] Length = 1281 Score = 74.7 bits (182), Expect = 3e-13 Identities = 38/49 (77%), Positives = 41/49 (83%), Gaps = 1/49 (2%) Frame = -2 Query: 213 MDS-GTNLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIR 70 MDS NLYETASQPD G DAYTFLEFNTQ +DF+YP+FQELSQPIR Sbjct: 1 MDSQANNLYETASQPDTGNDAYTFLEFNTQG--EDFDYPEFQELSQPIR 47 >XP_016511699.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Nicotiana tabacum] Length = 352 Score = 73.6 bits (179), Expect = 6e-13 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -2 Query: 198 NLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIRDKA 61 NLY+TASQPD G DAYTFLEFNTQ +E F+YP+FQELSQPIR A Sbjct: 7 NLYDTASQPDTGNDAYTFLEFNTQGEE--FDYPEFQELSQPIRSSA 50 >XP_015084953.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Solanum pennellii] Length = 1264 Score = 73.9 bits (180), Expect = 6e-13 Identities = 38/52 (73%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = -2 Query: 213 MDSG-TNLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIRDKA 61 MDS NLY+TASQPD G DAYTFLEFNTQ +E F+YP+FQELSQPIR A Sbjct: 1 MDSQPNNLYDTASQPDTGNDAYTFLEFNTQGEE--FDYPEFQELSQPIRSSA 50 >XP_006362492.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Solanum tuberosum] Length = 1264 Score = 73.9 bits (180), Expect = 6e-13 Identities = 38/52 (73%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = -2 Query: 213 MDSG-TNLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIRDKA 61 MDS NLY+TASQPD G DAYTFLEFNTQ +E F+YP+FQELSQPIR A Sbjct: 1 MDSQPNNLYDTASQPDTGNDAYTFLEFNTQGEE--FDYPEFQELSQPIRSSA 50 >XP_004244550.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Solanum lycopersicum] Length = 1264 Score = 73.9 bits (180), Expect = 6e-13 Identities = 38/52 (73%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = -2 Query: 213 MDSG-TNLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIRDKA 61 MDS NLY+TASQPD G DAYTFLEFNTQ +E F+YP+FQELSQPIR A Sbjct: 1 MDSQPNNLYDTASQPDTGNDAYTFLEFNTQGEE--FDYPEFQELSQPIRSSA 50 >XP_016458238.1 PREDICTED: regulator of nonsense transcripts 1 homolog, partial [Nicotiana tabacum] Length = 578 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -2 Query: 198 NLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIRDKA 61 NLY+TASQPD G DAYTFLEFNTQ +E F+YP+FQELSQPIR A Sbjct: 7 NLYDTASQPDTGNDAYTFLEFNTQGEE--FDYPEFQELSQPIRSSA 50 >XP_019228759.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Nicotiana attenuata] OIT30524.1 regulator of nonsense transcripts 1-like protein [Nicotiana attenuata] Length = 183 Score = 70.9 bits (172), Expect = 8e-13 Identities = 36/52 (69%), Positives = 41/52 (78%), Gaps = 1/52 (1%) Frame = -2 Query: 213 MDS-GTNLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIRDKA 61 MDS NLY+TASQPD G DAYTFLEF+TQ +E F+YP+F ELSQPIR A Sbjct: 1 MDSQANNLYDTASQPDTGNDAYTFLEFSTQGEE--FDYPEFHELSQPIRSSA 50 >XP_009626110.1 PREDICTED: regulator of nonsense transcripts 1 homolog isoform X2 [Nicotiana tomentosiformis] Length = 1269 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -2 Query: 198 NLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIRDKA 61 NLY+TASQPD G DAYTFLEFNTQ +E F+YP+FQELSQPIR A Sbjct: 7 NLYDTASQPDTGNDAYTFLEFNTQGEE--FDYPEFQELSQPIRSSA 50 >XP_009792531.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Nicotiana sylvestris] Length = 1272 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -2 Query: 198 NLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIRDKA 61 NLY+TASQPD G DAYTFLEFNTQ +E F+YP+FQELSQPIR A Sbjct: 7 NLYDTASQPDTGNDAYTFLEFNTQGEE--FDYPEFQELSQPIRSSA 50 >XP_019228197.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Nicotiana attenuata] OIT06211.1 regulator of nonsense transcripts 1-like protein [Nicotiana attenuata] Length = 1273 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -2 Query: 198 NLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIRDKA 61 NLY+TASQPD G DAYTFLEFNTQ +E F+YP+FQELSQPIR A Sbjct: 7 NLYDTASQPDTGNDAYTFLEFNTQGEE--FDYPEFQELSQPIRSSA 50 >XP_009626103.1 PREDICTED: regulator of nonsense transcripts 1 homolog isoform X1 [Nicotiana tomentosiformis] Length = 1273 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -2 Query: 198 NLYETASQPDAGPDAYTFLEFNTQADEDDFNYPQFQELSQPIRDKA 61 NLY+TASQPD G DAYTFLEFNTQ +E F+YP+FQELSQPIR A Sbjct: 7 NLYDTASQPDTGNDAYTFLEFNTQGEE--FDYPEFQELSQPIRSSA 50